Notice: SGN will be briefly unavailable for maintenance. Apologies.

ESTScan Details for Unigene SGN-U257752

Score 
547
Direction 
Forward
Predicted Peptide Sequence 
EEVASFSHSTRGAVNALSFSTDGQPLLASGGSSGVISIWNLEKRRLHSVIKEAHDSSIVSLQFFANEPVLMSSSADNSMKMWIFDTSDGE
PRLLRFRSGHSAPPLCIKFYANGRHILSAGQDRAFRLFSVVQDQQSRELSQRHVSKRAKKLKLKKEEIKLKPVIAFDVAEIRERDWCNVV
TCHMDTPRAYVWRLQNFVLGEHILTPCPENPTPVKLAAISACGNFAVLG
Predicted Coding Sequence 
GAAGAGGTAGCTTCATTTAGTCACTCTACAAGAGGCGCCGTTAATGCCTTGTCATTCAGCACTGATGGGCAGCCCCTTCTTGCTTCTGGA
GGTTCATCTGGTGTTATAAGCATATGGAATCTTGAGAAGAGAAGGCTGCACTCTGTCATCAAGGAGGCCCATGACTCTTCCATAGTTTCA
CTTCAGTTCTTTGCTAATGAGCCTGTCCTCATGAGTTCATCTGCAGATAATTCAATGAAAATGTGGATCTTCGATACAAGTGATGGGGAA
CCTCGTTTACTACGGTTTAGAAGTGGTCATAGTGCTCCTCCTCTATGTATCAAGTTCTATGCAAATGGGCGCCACATCTTATCTGCTGGT
CAAGATCGAGCCTTCCGTCTCTTTTCTGTTGTTCAAGATCAACAAAGTAGAGAACTTTCCCAGCGACATGTTTCTAAAAGAGCGAAGAAG
CTTAAGTTGAAAAAGGAGGAGATAAAATTGAAGCCTGTTATTGCATTCGATGTTGCTGAAATTAGGGAACGTGATTGGTGCAATGTGGTT
ACATGTCATATGGACACCCCGCGTGCTTATGTATGGAGGCTTCAAAATTTTGTTCTTGGCGAGCATATTTTAACTCCATGCCCTGAAAAT
CCAACTCCAGTCAAGCTTGCXGCTATTAGTGCCTGTGGAAACTTTGCTGTACTAGGX\
Edits in Original Sequence 
(5')GAAGAGGTAGCTTCATTTAGTCACTCTACAAGAGGCGCCGTTAATGCCTTGTCATTCAGCACTGATGGGCAGCCCCTTCTTGCTTC
TGGAGGTTCATCTGGTGTTATAAGCATATGGAATCTTGAGAAGAGAAGGCTGCACTCTGTCATCAAGGAGGCCCATGACTCTTCCATAGT
TTCACTTCAGTTCTTTGCTAATGAGCCTGTCCTCATGAGTTCATCTGCAGATAATTCAATGAAAATGTGGATCTTCGATACAAGTGATGG
GGAACCTCGTTTACTACGGTTTAGAAGTGGTCATAGTGCTCCTCCTCTATGTATCAAGTTCTATGCAAATGGGCGCCACATCTTATCTGC
TGGTCAAGATCGAGCCTTCCGTCTCTTTTCTGTTGTTCAAGATCAACAAAGTAGAGAACTTTCCCAGCGACATGTTTCTAAAAGAGCGAA
GAAGCTTAAGTTGAAAAAGGAGGAGATAAAATTGAAGCCTGTTATTGCATTCGATGTTGCTGAAATTAGGGAACGTGATTGGTGCAATGT
GGTTACATGTCATATGGACACCCCGCGTGCTTATGTATGGAGGCTTCAAAATTTTGTTCTTGGCGAGCATATTTTAACTCCATGCCCTGA
AAATCCAACTCCAGTCAAGCTTGCXGCTATTAGTGCCTGTGGAAACTTTGCTGTACTAGGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan