ESTScan Details for Unigene SGN-U258024

Score 
311
Direction 
Forward
Predicted Peptide Sequence 
IVGGSQNWKEGIIRFMNIGKMEAGKSASVKPTATTTCPFSSFLSQSTVTLTVNASQGEIRYRGMKPRREWIADWVSNNDDLVRSMPIYVG
GLSLLAVLFNRTVSGIAPVADASSSQSRADLLTLGLAVTNILNGLVWLSIRPKSISVVNPNGVECQRIASHLPDFVISELLWYCIYXAGT
VFEMGLYNLLIFIL
Predicted Coding Sequence 
XXTATAGTTGGAGGGTCTCAAAATTGGAAAGAAGGTATTATCCGTTTTATGAACATCGGGAAAATGGAAGCXGGGAAATCTGCTTCGGTT
AAACCAACCGCCACAACGACTTGTCCATTCTCGTCGTTTCTCTCACAGTCGACTGTTACTCTTACTGTTAATGCTTCTCAGGGAGAAATT
AGGTATAGAGGGATGAAGCCAAGGAGGGAATGGATAGCTGATTGGGTATCTAATAATGATGATTTGGTTCGGAGTATGCCAATTTATGTG
GGTGGATTGTCTTTATTGGCAGTTCTCTTCAATCGTACTGTTTCTGGTATTGCTCCGGTTGCTGATGCTAGCAGTTCTCAATCCAGAGCA
GATTTATTGACACTTGGGTTGGCAGTCACCAACATCTTGAATGGTCTTGTTTGGCTTTCAATCCGACCAAAATCCATATCTGTGGTAAAT
CCTAACGGTGTAGAGTGCCAAAGAATAGCTTCTCACCTACCAGATTTTGTTATTTCTGAGCTGCTATGGTATTGTATTTATGXAGCTGGA
ACAGTTTTTGAAATGGGTCTTTATAACTTGCTCATTTTTATACTTTGA\
Edits in Original Sequence 
(5')XXTATAGTTGGAGGGTCTCAAAATTGGAAAGAAGGTATTATCCGTTTTATGAACATCGGGAAAATGGAAGCXGGGAAATCTGCTTC
GGTTAAACCAACCGCCACAACGACTTGTCCATTCTCGTCGTTTCTCTCACAGTCGaACTGTTACTCTTACTGTTAATGCTTCTCAGGGAG
AAATTAGGTATAGAGGGATGAAGCCAAGGAGGGAATGGATAGCTGATTGGGTATCTAATAATGATGATTTGGTTCGGAGTATGCCAATTT
ATGTGGGTGGATTGTCTTTATTGGCAGTTCTCTTCAATCGTACTGTTTCTGGTATTGCTCCGGTTGCTGATGCTAGCAGTTCTCAATCCA
GAGCAGATTTATTGACACTTGGGTTGGCAGTCACCAACATCTTGAATGGTCTTGTTTGGCTTTCAATCCGACCAAAATCCATATCTGTGG
TAAATCCTAACGGTGTAGAGTGCCAAAGAATAGCTTCTCACCTACCAGATTTTGTTATTTCTGAGCTGCTATGGTATTGTATTTATGXAG
CTGGAACAGTTTTTGAAATGGGTCTTTATAACTTGCTCATTTTTATACTTTGA\(3')TATCACGTATAATATTAATTTGATATGGTTGT
GCGTTTATATACATATTACATAATTTATGTAATGAGTATGCATTGTACTCGAGGAAACACACTGATCATCTTTTTCTTGCCGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan