Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U258153

Score 
614
Direction 
Forward
Predicted Peptide Sequence 
MDSYKNQEETSDHNDAQEESGWTTYLEDFSMEQHNNNSENSTYCDSFGSPSLLSDAASHAVWNNCNNNNYGSPFLKRLNLKKPRNKKISD
PDLEDTASSPVNSPKVSFNKQMDINYRRTDNNNGNFLGFEGGSRQQQEMETIERNSTVCFDEKNKSYMDLEKKXTLFGAFVHVGXTIEAD
GHLRCAFSFD
Predicted Coding Sequence 
ATGGATTCATATAAGAATCAAGAAGAAACAAGTGATCATAATGATGCACAAGAAGAAAGTGGATGGACAACTTATTTGGAGGATTTTTCA
ATGGAACAACATAACAATAATAGTGAAAATAGCACATATTGTGATAGTTTTGGAAGTCCCTCTTTGTTGTCTGATGCTGCTTCTCATGCT
GTTTGGAACAATTGTAACAACAATAATTATGGGTCACCATTTCTTAAGAGATTGAATTTGAAGAAACCAAGGAACAAGAAAATCTCTGAT
CCTGATTTAGAAGACACTGCTAGCTCACCTGTCAATAGTCCTAAGGTAAGTTTTAATAAGCAAATGGACATCAATTACCGAAGAACAGAC
AACAATAATGGAAATTTTCTGGGATTTGAAGGTGGCTCTAGACAACAACAAGAAATGGAGACAATAGAAAGAAATAGTACTGTGTGTTTT
GATGAAAAGAACAAAAGTTATATGGACCTCGAGAAGAAGGXGACTTTGTTTGGTGCCTTTGTCCATGTTGGTXCAACTATAGAGGCTGAT
GGTCATTTGCGCTGCGCGTTCTCGTTTGATTAA\
Edits in Original Sequence 
CAAACAATTATATTTCCCCAAATTAAAGCACTTTAATCTAGTCTTATAAGAAA(5')ATGGATTCATATAAGAATCAAGAAGAAACAAGT
GATCATAATGATGCACAAGAAGAAAGTGGATGGACAACTTATTTGGAGGATTTTTCAATGGAACAACATAACAATAATAGTGAAAATAGC
ACATATTGTGATAGTTTTGGAAGTCCCTCTTTGTTGTCTGATGCTGCTTCTCATGCTGTTTGGAACAATTGTAACAACAATAATTATGGG
TCACCATTTCTTAAGAGATTGAATTTGAAGAAACCAAGGAACAAGAAAATCTCTGATCCTGATTTAGAAGACACTGCTAGCTCACCTGTC
AATAGTCCTAAGGTAAGTTTTAATAAGCAAATGGACATCAATTACCGAAGAACAGACAACAATAATGGAAATTTTCTGGGATTTGAAGGT
GGCTCTAGACAACAACAAGAAATGGAGACAATAGAAAGAAATAGTACTGTGTGTTTTGATGAAAAGAACAAAAGTTATATGGACCTCGAG
AAGAAGGXGACTTTGTTTGGTGCCTTTGTCCATGTTGGTXCAACTATAGAGGCTGATGGTCATTTGCGCTGCGCGTTCTCGTTTGATTAA
\(3')TACATATTAGATATAGAAAGTATAATTCCGAAAGTGACTTTGATTTGTCAGTTTAAGCTCAAGTACTCTTTGCTTTAAGTTAGCG
GAACTATATAAAAAAAAAGTCTATTTAATTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan