ESTScan Details for Unigene SGN-U258164

Score 
558
Direction 
Forward
Predicted Peptide Sequence 
KWPLQPSPSPSLSFFLDPRRRQDNLVSPAAVASSQCVTLPTLPPPPAVQSRAARTTAYCRKIARNVAAMATSTGEVATAEATGETATTEL
PSELVQKIQEVWDKVDDKYAVSSLGVAAFILLWSSTGVISAIDRLPLIPGVLELVGIGYTGWFAYKNLIFKPDREALIVKIKELYKDILG
AAKRKQSPDAAAET
Predicted Coding Sequence 
XXCAAATGGCCTCTACAACCTTCCCCTTCACCTTCTCTCTCTTTCTTCCTCGACCCTCGTCGACGGCAAGACAACCTCGTCAGTCCXGCT
GCCGTGGCATCGTCGCAATGTGTGACACTACCCACCCTTCCACCGCCGCCGGCCGTTCAAAGCCGTGCTGCCAGAACCACTGCTTACTGT
AGAAAGATTGCAAGGAATGTGGCCGCAATGGCTACATCAACTGGAGAAGTTGCCACAGCAGAGGCCACAGGAGAAACGGCAACCACTGAG
CTACCATCAGAGCTTGTCCAAAAAATTCAAGAAGTTTGGGACAAAGTTGATGATAAGTACGCAGTCAGTTCATTGGGTGTTGCTGCATTT
ATTCTGCTTTGGAGCTCCACTGGAGTGATCTCGGCAATTGACAGGCTTCCTTTGATTCCTGGTGTTCTTGAGCTTGTAGGAATTGGTTAC
ACCGGTTGGTTTGCCTACAAGAACTTGATCTTCAAACCCGACAGAGAAGCTTTGATAGTAAAGATCAAGGAATTGTACAAGGATATTCTT
GGAGCAGCTAAACGGAAACAGAGTCCCGATGCTGCTGCAGAGACATGA\
Edits in Original Sequence 
(5')XXCAAATGGCCTCTACAACCTTCCCCTTCACCTTCTCTCTCTTTCTTCCTCGACCCTCGTCGACGGCAAGACAACCTCGTCAGTCC
XGCTGCCGTGGCATCGTCGCAATGTGTGACACTACCCACCCTTCCACCGCCGCCGGCCGTTCAAAGCCGTGCTGCCAGAACCACTGCTTA
CTGTAGAAAGATTGCAAGGAATGTGGCCGCAATGGCTACATCAACTGGAGAAGTTGCCACAGCAGAGGCCACAGGAGAAACGGCAACCAC
TGAGCTACCATCAGAGCTTGTCCAAAAAATTCAAGAAGTTTGGGACAAAGTTGATGATAAGTACGCAGTCAGTTCATTGGGTGTTGCTGC
ATTTATTCTGCTTTGGAGCTCCACTGGAGTGATCTCGGCAATTGACAGGCTTCCTTTGATTCCTGGTGTTCTTGAGCTTGTAGGAATTGG
TTACACCGGTTGGTTTGCCTACAAGAACTTGATCTTCAAACCCGACAGAGAAGCTTTGATAGTAAAGATCAAGGAATTGTACAAGGATAT
TCTTgGGAGCAGCTAAACGGAAACAGAGTCCCGATGCTGCTGCAGAGACATGA\(3')TCAAAATAGATTTCAGTTGAGCAATCTTGCAG
CTTTGCTCTTCAAAATGTAAACTCTGCTTCGNTCTTTTGCTATCTTTTTATTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan