ESTScan Details for Unigene SGN-U258705

Score 
305
Direction 
Forward
Predicted Peptide Sequence 
FPVSSSSSPSGKQHSEKTKRTAMAPVMQSSQPWVEKYRPKKVKDVAHQDEVVRVLTNTLETSNCPHMLFYGPPGTGKTTTALAIAHQLFG
PELYKSRVLELNASDDRGINVVRTKIKNFAAVAVGSNX
Predicted Coding Sequence 
XATTTTCCCGTTTCTTCTTCTTCCTCTCCAAGCGGGAAACAGCACTCTGAGAAAACAAAGAGAACAGCTATGGCGCCAGTTATGCAAAGC
TCTCAGCCATGGGTCGAGAAATATCGACCGAAGAAAGTGAAGGATGTAGCTCACCAGGATGAGGTCGTTCGAGTCCTCACCAACACTCTC
GAGACCTCTAACTGCCCGCATATGCTGTTTTATGGTCCTCCTGGAACTGGAAAGACGACCACTGCTCTTGCCATTGCCCATCAGCTTTTT
GGACCTGAGCTGTATAAGTCGAGGGTATTGGAGCTAAATGCTAGTGATGACCGTGGTATCAATGTAGTTCGCACAAAAATTAAGAACTTT
GCTGCTGTTGCTGTAGGTTCTAATCXX\
Edits in Original Sequence 
(5')XATTTTCCCGTTTCTTCTTCTTCCTCTCCAAGCGGGAAACAGCACTCTGAGAAAACAAAGAGAACAGCTATGGCGCCAGTTATGCA
AAGCTCTCAGCCATGGGTCGAGAAATATCGACCGAAGAAAGTGAAGGATGTAGCTCACCAGGATGAGGTCGTTCGAGTCCTCACCAACAC
TCTCGAGACCTCTAACTGCCCGCATATGCTGTTTTATGGTCCTCCTGGAACTGGAAAGACGACCACTGCTCTTGCCATTGCCCATCAGCT
TTTTGGACCTGAGCTGTATAAGTCGAGGGTATTGGAGCTAAATGCTAGTGATGACCGTGGTATCAATGTAGTTCGCACAAAAATTAAGAA
CTTTGCTGCTGTTGCTGTAGGTTCTAATCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan