ESTScan Details for Unigene SGN-U259128

Score 
238
Direction 
Reverse
Predicted Peptide Sequence 
NKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGVINGHKYKFXFMSALVIYTFDVLNLISCPTCRDGNLHFVES
PALAPPEVQIDLAAQAL
Predicted Coding Sequence 
XGAAACAAAGTTGATGTGAAGAACAGGCAGGTTAAGGCAAAGCAAGTTACCTTCCACAGGAAGAAAAATTTGCAATACTATGAGATCTCG
GCAAAGAGTAACTACAACTTTGAGAAGCCTTTTCTGTACCTTGCTAGAAAGCTTGCTGGXGTAATTAATGGTCATAAATATAAATTTXAT
TTCATGTCTGCTCTTGTCATATATACTTTTGATGTATTGAACCTAATTTCTTGTCCTACTTGTAGGGATGGCAATCTTCACTTTGTGGAA
TCACCAGCACTTGCTCCCCCAGAAGTACAAATTGACTTAGCTGCACAGGCACTGTAA\
Edits in Original Sequence 
(5')XGAAACAAAGTTGATGTGAAGAACAGGCAGGTTAAGGCAAAGCAAGTTACCTTCCACAGGAAGAAAAATTTGCAATACTATGAGAT
CTCGGCAAAGAGTAACTACAACTTTGAGAAGCCTTTTCTGTACCTTGCTAGAAAGCTTGCTGGXGTAATTAATGGTCATAAATATAAATT
TXATTTCATGTCTGCTCTTGTCATATATACTTTTGATGTATTGAACCTAATTTCTTGTCCTACTTGTAGGGATGGCAATCTTCACTTTGT
GGAATCACCAGCACTTGCTCCCCCAGAAGTACAAATTGACTTAGCTGCACAGGCACTGTAA\(3')GAGCTCTGTTTACTTTTGGTGCTT
CATTATTTTTTGTTTCTGCTAATATCTAAGTTTTATATGAGTATTCCATAGAATTAAGAACTGTCAGCAAATCTGTGATAATATCAGATA
TTCACTTCTTTATATGTATATCAAAGTTAGGCAATGCTCATTGCATCTTAATACGTAACGATTTTGATCATGAGCAACCCTTGTATCTTC
AAGAATACTAATAAGTATTAGGTTCCTGCTTGGTTATGTGATGAGCTAGGCTCCTTGTGCTTAACATTTTGTTTTCTTGTACGATTTTTA
ATTTTGACTGTTCTGTTTATTCAGGCATGAACAGGAGCTTCAACAAGCCCTTAATCAGCCACTTCCAGATGACGATGATGAAGCATTTGA
ATAGATGGCATAGCTCAGAGCAGATCAGTTTCACCGTTGCACCTTCCCAAATTCCTAGTCCTTAATTTTTCTGTATTTGGACTTTTGTCT
TTGTTATTTGAGGATCTATTTGTTGCTTCCTTGTATTATTGATTGGTTATTAGATATGTTTGTCTGCGGCCACGAGGCTTTGTTTTGTTA
GGTTAGTAAAACCGACCTTCATTATCGAGGCTCTGTTTTGAGCTCCTGTTTGGATACTTGGTCACATATCCGACAATTTTTGACTGAAAA
AAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan