Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U259236

Score 
557
Direction 
Forward
Predicted Peptide Sequence 
MAEFIEDTNTKNKNEDPSISLVSDGKSSSEPSKNDQVVETQPENSTQNQEKENIIAQQGQEEEEEMNANDEERANFSTPPGKRSAPKPKT
G
Predicted Coding Sequence 
ATGGCTGAGTTCATTGAAGATACAAATACAAAGAACAAGAATGAAGATCCATCCATAAGCCTTGTTTCTGATGGAAAATCTTCTAGTGAA
CCATCAAAAAATGACCAAGTAGTAGAAACACAACCAGAAAATAGTACACAAAATCAAGAAAAAGAAAATATTATTGCTCAACAAGGCCAA
GAAGAAGAGGAGGAGATGAATGCTAATGATGAGGAAAGAGCAAATTTTTCAACACCTCCAGGAAAAAGATCAGCTCCTAAACCTAAGACG
GGTTGA\
Edits in Original Sequence 
TTCAAATAGAAAGTATGCATTGAATTCAATATTTAATCTCTTATATAAAGCTCATTCGATATGAGGGAGATAATAGCTAAGGAGAAAAGA
AAAG
(5')ATGGCTGAGTTCATTGAAGATACAAATACAAAGAACAAGAATGAAGATCCATCCATAAGCCTTGTTTCTGATGGAAAATCTT
CTAGTGAACCATCAAAAAATGACCAAGTAGTAGAAACACAACCAGAAAATAGTACACAAAATCAAGAAAAAGAAAATATTATTGCTCAAC
AAGGCCAAGAAGAAGAGGAGGAGATGAATGCTAATGATGAGGAAAGAGCAAATTTTTCAACACCTCCAGGAAAAAGATCAGCTCCTAAAC
CTAAGACGGGTTGA\(3')AATTAATTAATTAATTAAGTCTTTGGGAATTCCAATATTGTGATAATTATTTCAAGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan