ESTScan Details for Unigene SGN-U259285

Score 
107
Direction 
Forward
Predicted Peptide Sequence 
IIFTETLALASELAVAYVPVGKCFAWGRYPTELSVRAYHLKRFRSVKIHXALVATNVAARGLDIDDVQLIIQCEATSDVEAYIHRSGRTG
RAGKSGVAVMLYDPRKSNISRIEKESGVTFEHX
Predicted Coding Sequence 
ATTATTTTTACTGAGACATTGGCGCTAGCTTCAGAGCTAGCXGTGGCTTATGTGCCTGTTGGCAAGTGCTTTGCATGGGGCAGATACCCA
ACAGAACTCAGCGTGAGGGCTTATCACTTAAAGAGATTCAGATCAGTGAAAATTCATGXAGCATTAGTGGCCACAAATGTAGCAGCCCGT
GGATTGGATATCGATGATGTTCAGTTAATTATCCAGTGCGAAGCCACTAGTGATGTTGAAGCATACATTCATCGATCTGGAAGGACAGGA
CGGGCAGGAAAGAGTGGTGTGGCTGTAATGCTGTATGATCCAAGGAAGTCCAACATTTCTAGAATTGAAAAAGAATCTGGTGTGACGTTT
GAGCATTTX\
Edits in Original Sequence 
(5')ATTATTTTTACTGAGACATTGGCGCTAGCTTCAGAGCTAGCXGTGGCTTATGTGCCTGTTGGCAAGTGCTTTGCATGGGGCAGATA
CCCAACAGAACTCAGCGTGAGGGCTTATCACTTAAAGAGATTCAGATCAGTGAAAATTCATGXAGCATTAGTGGCCACAAATGTAGCAGa
CCCGTGGATTGGATATCGATGATGTTCAGTTAATTATCCAGTGCGAAGCCACTAGTGATGTTGAAGCATACATTCATCGATCTGGAAGGA
CAGGACGGGCAGGAAAGAGTGGTGTGGCTGTAATGCTGTATGATCCAAGGAAGTCCAACATTTCTAGAATTGAAAAAGAATCTGGTGTGA
CGTTTGAGCATTTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan