ESTScan Details for Unigene SGN-U260249

Score 
395
Direction 
Forward
Predicted Peptide Sequence 
AETPSVPAPTGSDPDYWCYQCETRVAVETLPDLPADVICSNCKSGFVESIPSRVVSVSPVTASTDQIDDPAFGNQFIQVLRLIAEAARDN
EGPPPPPSEHADPTDDDDDDDDDVDDVDEDEEVENRDDDEEDLQRRRRDVLRLRLRDFAARAANXAKPDSGLGRDFDGTGRPLYELRFQV
PDGDGYIGNPGDYVDAAGYEALLQTLPRVMVAEDEXAPPASKSAIEGLKHLVI
Predicted Coding Sequence 
GCCGAGACCCCTTCAGTCCCTGCACCAACCGGGTCGGATCCTGATTACTGGTGCTACCAGTGTGAGACACGGGTTGCCGTCGAAACCCTA
CCCGATCTCCCCGCCGATGTCATTTGCAGCAACTGTAAGAGTGGCTTCGTCGAGTCCATACCCTCTCGTGTTGTTTCTGTCTCTCCGGTG
ACGGCGTCTACTGATCAGATCGATGACCCTGCTTTCGGCAATCAGTTCATCCAGGTTCTTCGCCTCATAGCTGAAGCGGCGCGTGACAAC
GAGGGGCCCCCTCCCCCGCCTTCTGAGCACGCTGATCCTACCGATGACGACGATGATGATGATGATGATGTTGATGATGTTGATGAGGAT
GAAGAAGTTGAGAATCGGGATGATGATGAAGAGGACCTTCAGAGAAGGAGGAGGGATGTGCTACGTCTCCGGCTACGTGACTTCGCCGCC
AGAGCTGCCAATXCGGCGAAACCGGATTCTGGATTGGGCAGAGATTTTGATGGGACTGGAAGACCACTCTATGAGCTCCGATTTCAAGTT
CCTGATGGCGATGGCTACATCGGGAACCCTGGAGACTATGTGGACGCAGCGGGTTATGAAGCTTTACTGCAAACCCTACCGAGAGTGATG
GTAGCGGAAGACGAGGXAGCTCCACCAGCTTCCAAGAGTGCAATTGAGGGTCTCAAACATTTGGTGATC\
Edits in Original Sequence 
(5')GCCGAGACCCCTTCAGTCCCTGCACCAACCGGGTCGGATCCTGATTACTGGTGCTACCAGTGTGAGACACGGGTTGCCGTCGAAAC
CCTACCCGATCTCCCCGCCGATGTCATTTGCAGCAACTGTAAGAGTGGCTTCGTCGAGTCCATACCCTCTCGTGTTGTTTCTGTCTCTCC
GGTGACGGCGTCTACTGATCAGATCGATGACCCTGCTTTCGGCAATCAGTTCATCCAGGTTCTTCGCCTCATAGCTGAAGCGGCGCGTGA
CAACGAGGGGCCCCCTCCCCCGCCTTCTGAGCACGCTGATCCTACCGATGACGACGATGATGATGATGATGATGTTGATGATGTTGATGA
GGATGAAGAAGTTGAGAATCGGGATGATGATGAAGAGGACCTTCAGAGAAGGAGGAGGGATGTGCTACGTCTCCGGCTACGTGACTTCGC
CGCCAGAGCTGCCAATXCGGCGAAACCGGATTCTGGATTGGGCAGAGATTTTGATGGGACTGGAAGACCACTCTAtTGAGCTCCGATTTC
AAGTTCCTGATGGCGATGGCTACATCGGGAACCCTGGAGACTATGTGGACGCAGCGGGTTATGAAGCTTTACTGCAAACCCTACCGAGAG
TGATGGTAGCGGAAGACGAGGXAGCTCCACCAGCTTCCAAGAGTGCAATTGAGGGTCTCAAACATTTGGTGATC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan