ESTScan Details for Unigene SGN-U260470

Score 
289
Direction 
Reverse
Predicted Peptide Sequence 
MSNLRGETRAELEMIEEYDDSNDESMRGMYEPDWDLWEEWMGWEGAGIRDYTSHVNPYI
Predicted Coding Sequence 
ATGAGTAATTTGAGAGGTGAAACAAGAGCAGAGTTAGAGATGATTGAGGAATATGATGATAGTAATGATGAATCGATGAGAGGAATGTAT
GAACCAGATTGGGATCTATGGGAAGAGTGGATGGGATGGGAAGGTGCTGGCATTCGTGATTATACTTCTCATGTTAATCCTTACATATGA
\
Edits in Original Sequence 
GGTTTTTTCTGACCAATAAAATCAACTTGTAAAAATGGTCATTTTTAAATAGAAAAATGATATGATCCATCCGACTTTGACTTGTTTGAG
ATTGAGACGTAGTTTATATTTTGTTATATAAAATCTTTTGGCTGATGTGATTATGGTGTGTTGCAGGTTGTG
(5')ATGAGTAATTTGAG
AGGTGAAACAAGAGCAGAGTTAGAGATGATTGAGGAATATGATGATAGTAATGATGAATCGATGAGAGGAATGTATGAACCAGATTGGGA
TCTATGGGAAGAGTGGATGGGATGGGAAGGTGCTGGCATTCGTGATTATACTTCTCATGTTAATCCTTACATATGA\(3')ATGGGTATT
TATCTTATTAGTCGAAAACCCAAGAATTTAAGACCCATCCATCTTCTTTAAATCAAAGATGGTTTGAGGTTTTATGTACATAAATCAATA
GGAAGTAGAGGAGGTTCTTTTTGTACATATATGGATTCCCTCCTTATTTGCTCTCACCNAATTGTATTCATATCTCGTTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan