ESTScan Details for Unigene SGN-U261532

Score 
439
Direction 
Forward
Predicted Peptide Sequence 
MAAATSLYRVRDASEVXVKFSGVARPAAPSPSSSATFKTVALFKKKAAAPAKAKAAAVSPADDELAKWYGE
Predicted Coding Sequence 
ATGGCTGCAGCTACCTCTCTATACCGTGTCCGAGATGCCTCGGAAGTCXCCGTCAAGTTTAGCGGTGTTGCAAGGCCTGCTGCCCCTTCT
CCATCCTCCTCTGCTACCTTCAAAACTGTTGCCCTTTTCAAAAAGAAGGCTGCAGCTCCTGCCAAAGCTAAGGCTGCCGCTGTCTCTCCT
GCTGACGATGAGCTCGCAAAGTGGTACGGTGAGTAA\
Edits in Original Sequence 
CGAGGTAAAA(5')ATGGCTGCAGCTACCTCTCTATACCGTGTCCGAGATGCCTCGGAAGTCXCCGTCAAGTTTAGCGGTGTTGCAAGGC
CTGCTGCCCCTTCTCCATCCTCCTCTGCTACCTTCAAAACTGTTGCCCTTTTCAAAAAGAAGGCTGCAGCTCCTGCCAAAGCTAAGGCTG
CCGCTGTCTCTCCTGCTGACGATGAGCTCGCAAAGTGGTACGGTGAGTAA\(3')CATTGCTACTTTCCCTTTTATGAGTTTGATTGGAC
ATGAAATTTAATGCAGTAGTCGTATTAATTGTAACAGAGTAGTACTACATTACATTTTCTCCCTTTATAAGTGAACCTATTATATTTCGC
ACTGAATTATATTAAAATTGTAGATTAACGTCTGACTGTACTGTAACTAATGTCGAACTGAACGGAAGAGTAGACTCCTAAGTTCATGCA
GCCTCTGTTTAACATCTTCCCTTTGGCTTTTATATGCTTAAATTTTGGGAATATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan