ESTScan Details for Unigene SGN-U262779

Score 
301
Direction 
Forward
Predicted Peptide Sequence 
FFNFASKKDAKDVGSLIVLNRNESMFPKGYRDKAGVISFVDRRVALEMAENARERWKRREITNFEYLMALNTLAGRSYNDLTQYPVFPWI
LADYSSETLDFNKSSTFRDLSKPVGALDAKRFEVFEDRYRSFSDPDIPSFYYGSHYSSMGIXAILPPETGTFYX
Predicted Coding Sequence 
TTTTTTAACTTTGCTTCGAAAAAGGATGCCAAAGACGTTGGAAGCTTAATAGTTCTAAACAGAAACGAAAGTATGTTTCCCAAGGGTTAC
AGGGACAAGGCTGGAGTTATTTCTTTTGTGGACAGACGTGTGGCATTGGAGATGGCAGAAAATGCTAGAGAACGCTGGAAGAGGAGGGAG
ATAACAAACTTTGAGTATTTGATGGCTCTGAACACTCTAGCTGGGAGATCTTACAATGATCTGACCCAGTATCCCGTGTTCCCTTGGATT
CTGGCTGATTATTCCTCGGAAACTCTTGATTTTAACAAATCTTCTACCTTTAGGGATCTATCAAAACCTGTTGGAGCACTGGATGCTAAA
AGGTTCGAGGTTTTTGAGGATAGATATCGCAGCTTCTCTGACCCTGATATTCCCAGTTTTTACTACGGTTCTCATTACTCGAGCATGGGA
ATTGXTGCTATTTTACCTCCTGAGACTGGAACCTTTTACAXX\
Edits in Original Sequence 
(5')TTTTTTAACTTTGCTTCGAAAAAGGATGCCAAAGACGTTGGAAGCTTAATAGTTCTAAACAGAAACGAAAGTATGTTTCCCAAGGG
TTACAGGGACAAGGCTGGAGTTATTTCTTTTGTGGACAGACGTGTGGCATTGGAGATGGCAGAAAATGCTAGAGAACGCTGGAAGAGGAG
GGAGATAACAAACTTTGAGTATTTGATGGCTCTGAACACTCTAGCTGGGAGATCTTACAATGATCTGACCCAGTATCCCGTGTTCCCTTG
GATTCTGGCTGATTATTCCTCGGAAACTCTTGATTTTAACAAATCTTCTACCTTTAGGGATCTATCAAAACCTGTTGGAGCACTGGATGC
TAAAAGGTTCGAGGTTTTTGAGGATAGATATCGCAGCTTCTCTGACCCTGATATTCCCAGTTTTTACTACGGTTCTCATTACTCGAGCAT
GGGAATTGXTGCTATTTTACCTCCTGAGACTGGAACCTTTTACAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan