ESTScan Details for Unigene SGN-U262922

Score 
391
Direction 
Forward
Predicted Peptide Sequence 
HDDEPNVKRMKTTVETPILSSSHKAESAXPRLLCRQGSEVDILDDGFKWRKYGQKVVKGNHHPVRVGFAGVIIVAHTLGCNVRKHVERAS
ADPKAVITTYEGKHNHDIPIAETEAIAQAQNSSRQLNEQEIATWWPSLLEKVALHTNEIPVCRAAERGTYCSIICITKREKGEYLSFVYL
Predicted Coding Sequence 
CATGATGATGAACCAAATGTGAAGAGAATGAAGACAACAGTTGAGACTCCTATTCTTTCATCATCACATAAAGCAGAATCAGCAXATCCA
AGATTGTTGTGCAGACAAGGGAGTGAAGTAGACATTTTGGATGACGGGTTCAAGTGGCGTAAATATGGGCAGAAAGTGGTGAAAGGGAAT
CATCATCCAGTCAGAGTTGGATTTGCAGGAGTTATTATCGTTGCACATACCCTGGGATGCAATGTTCGCAAACATGTTGAGAGAGCTTCA
GCAGATCCAAAAGCTGTCATAACAACGTATGAGGGCAAGCACAATCATGATATTCCCATTGCTGAAACAGAAGCCATAGCACAGGCCCAA
AATAGTAGTCGTCAGCTGAACGAGCAAGAGATTGCAACTTGGTGGCCTTCACTTCTCGAAAAAGTTGCTCTTCATACCAATGAAATACCA
GTGTGTAGGGCAGCTGAAAGAGGAACATATTGCAGCATAATTTGCATTACTAAAAGGGAAAAGGGTGAATATTTATCTTTTGTCTATCTX
\
Edits in Original Sequence 
(5')CATGATGATGAACCAAATGTGAAGAGAATGAAGACAACAGTTGAGACTCCTATTCTTTCATCATCACATAAAGCAGAATCAGCAXA
TCCAAGATTGTTGTGCAGACAAGGGAGTGAAGTAGACATTTTGGATGACGGGTTCAAGTGGCGTAAATATGGGCAGAAAGTGGTGAAAGG
GAATCATCATCCgAGTCAGAGTTGGATTTGCAGGAGTTATTATCGTTGCACATACCCTGGGATGCAATGTTCGCAAACATGTTGAGAGAG
CTTCAGCAGATCCAAAAGCTGTCATAACAACGTATGAGGGCAAGCACAATCATGATATTCCCATTGCTaGAAACAGAAGCCATAGCACAG
GCCCAAAATAGTAGTCGTCAGCTGAACGAGCAAGAGATTGCAACTTGGTaGGCCTTCACTTCTCGAAAAAGTTGCTCTTCATACCAATGA
AATACCAGTGTGTAGGGCAGCTGAAAGAGGAACATATTGCAGCATAATTTGCATTACTAAAAGGGAAAAGGGTGAATATTTATCTTTTGT
CTATCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan