ESTScan Details for Unigene SGN-U263030

Score 
336
Direction 
Forward
Predicted Peptide Sequence 
KPCALKFNPFPFFPKWVSSLALRTFSFMHFGGIDIDSYTLCSSITASSAVKDVKFGQMIHTLVRKSGWFSSVYVGCALVDLYAKSLCIKN
AAKMFDEIPXEEYSVVNAILSGYSEANMXDGGPGIGEEDAMFKFMFDNFTFSAALRACVGLSAFELGKQVHGCVIRKVHDVESDXVSAKP
VD
Predicted Coding Sequence 
XXGAAACCCTGTGCTCTTAAATTCAATCCTTTCCCATTTTTCCCAAAATGGGTTTCTTCTCTTGCTCTTCGAACATTCTCTTTCATGCAT
TTTGGTGGTATTGACATTGATTCATACACGTTGTGTAGCTCCATTACAGCTTCATCTGCTGTGAAAGATGTGAAATTTGGGCAAATGATT
CATACCCTTGTGCGGAAATCGGGTTGGTTTTCTAGTGTTTATGTGGGGTGTGCTTTAGTGGATTTGTATGCGAAGTCGTTGTGTATCAAG
AATGCAGCTAAGATGTTCGATGAAATTCCTGXTGAAGAATACAGTGTGGTGAATGCAATTCTTTCAGGTTATTCTGAAGCTAACATGXTG
GATGGAGGGCCTGGCATTGGTGAGGAAGATGCCATGTTTAAATTTATGTTTGATAATTTCACTTTTTCAGCTGCTTTGCGTGCTTGCGTT
GGGCTCTCTGCATTTGAATTGGGTAAGCAGGTTCATGGATGTGTTATTCGAAAAGTTCATGATGTGGAATCTGATGXTGTTTCTGCAAAG
CCTGTTGATTGA\
Edits in Original Sequence 
(5')XXGAAACCCTGTGCTCTTAAATTCAATCCTTTCCCATTTTTCCCAAAATGGGTTTCaTTCTCTTGCTCTTCGAACATTCTCTTTCA
TGCATTTTGGTGGTATTGACATTGATTCATACACGTTGTGTAGCTCCATTACAGCTTCATCTGCTGTGAAAGATGTGAAATTTGGGCAAA
TGATTCATACCCTTGTGCGGAAATCGGGTTGGTTTTCTAGTGTTTATGTGGGGTGTGCTTTAGTGGATTTGTATGCGAAGTCGTTGTGTA
TCAAGAATGCAGCTAAGATGTTCGATGAAATTCCTGXTGAAGAATACAGTGTGcGTGAATGCAATTCTTTCAGGTTATTCTGAAGCTAAC
ATGXTGGATGGAGGGCCTGGCATTGGTGAGGAAGATGCCATGTTTAAATTTATGTTTgGATAATTTCACTTTTTCAGCTGCTTTGCGTGC
TTGCGTTGGGCTCTCTGCATTTGAATTGGGTAAGCAGGTTCATGGATGTGTTATTCGAAAAGTTCATGATGTGGAATCTGATGXTGTTTC
TGCAAAGCCTGTTGATTGA\(3')AATGTATGGAAAATGTGGGTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan