ESTScan Details for Unigene SGN-U263199

Score 
495
Direction 
Forward
Predicted Peptide Sequence 
TTQYERPVATSHVGAAQHKSSVSVSSSVEKPSQSECPGPGDNRGTNGALSKLSSGEGIQTAKVSELSRDETSAPKGYSAPAAASDISPDA
YRRQHEISVTGGDVPPPFTSFEATGFPSEILREIHQAGFPAPSPIQAQSWPIALQGRDIVAVAKTGSGKTLGFLLPGFFLLKQRRSNPQ
Predicted Coding Sequence 
XATACTACCCAATACGAGAGGCCTGTTGCTACTTCTCATGTGGGTGCTGCACAACATAAATCGTCTGTATCTGTAAGTTCATCAGTTGAG
AAGCCTTCTCAAAGTGAATGTCCTGGACCTGGTGACAACAGAGGTACCAATGGTGCATTGAGCAAACTTTCCTCTGGAGAGGGCATTCAG
ACTGCAAAAGTAAGTGAGCTTTCCCGCGATGAAACATCTGCGCCAAAAGGTTATAGTGCTCCAGCTGCTGCAAGTGACATATCTCCAGAT
GCCTATCGCCGTCAGCATGAAATTTCTGTCACAGGAGGTGATGTGCCCCCACCTTTCACATCGTTTGAAGCTACTGGGTTTCCTTCGGAG
ATTTTGAGGGAGATACATCAAGCTGGGTTTCCTGCTCCTTCCCCAATACAGGCACAGTCCTGGCCCATTGCACTTCAGGGCCGTGACATA
GTAGCTGTTGCAAAGACTGGGTCTGGAAAAACTTTGGGTTTCTTGCTTCCTGGCTTTTTTCTTCTAAAGCAACGTCGGAGTAATCCTCAA
\
Edits in Original Sequence 
(5')XATACTACCCAATACGAGAGGCCTGTTGCTACTTCTCATGTGGGTGCTGCACAACATAAATCGTCTGTATCTGTAAGTTCATCAGT
TGAGAAGCCTTCTCAAAGTGAATGTCCTGGACCgTGGTGACAACAGAGGTACCAATGGTGCATTGAGCAAACTTTCCTCTGGAGAGGGCA
TTCAGACTGCAAAAGTAAGTGAGCTTTCCCGCGATGAAACATCTGCGCCAAAAGGTTATAGTGCTCCAGCTGCTGCAAGTGACATATCTC
CAGATGCCTATCGCCGTCAGCATGAAATTTCTGTCACAGGAGGTGATGTGCCCCCACCTTTCACATCGTTTGAAGCTACTGGGTTTCCTT
CGGAGATTTTGAGGGAGATACATCAAGCTGGGTTTCCTGCTCCTTCCCCAATACAGGCACAGTCCTGGCCCATTGCACTTCAGGGCCGTG
ACATAGTAGCTGTTGCAAAGACTGGGTCTGGAAAAACTTTGGGTTTCTTGCTTCCTGGCTTTTTTCTTCTAAAGCAACGTCGGAGTAATC
CTCAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan