ESTScan Details for Unigene SGN-U264010

Score 
221
Direction 
Reverse
Predicted Peptide Sequence 
NGHGSDGPDCGKDSLGGKENSEKVNIGALEWNFYKHMGKSFFPYPTFYXVKFAFTTPEQFGDDLTEGNNQVFQVAETVAGLTKQDRVAQR
KLLYCLSLCPISIFHNTVQDEFGINKGNGVFFPTQSPSGEYFNWVV
Predicted Coding Sequence 
XXTAATGGCCATGGTAGTGATGGCCCAGATTGTGGCAAGGACTCCCTTGGTGGCAAGGAGAATAGCGAGAAAGTCAATATTGGGGCXCTT
GAGTGGAATTTCTACAAACACATGGGAAAATCATTTTTTCCTTATCCTACATTTTATGXAGTAAAGTTTGCCTTCACGACACCAGAGCAG
TTTGGTGATGATTTGACTGAAGGTAATAATCAGGTTTTCCAGGTCGCAGAAACTGTTGCAGGGTTGACAAAGCAAGATAGAGTAGCCCAA
CGCAAGCTGTTGTACTGTTTGAGTCTCTGTCCAATTTCGATTTTTCATAATACAGTTCAAGATGAATTTGGAATCAACAAGGGGAATGGG
GTTTTTTTCCCTACTCAATCCCCCAGTGGTGAATATTTCAACTGGGTGGTGTAA\
Edits in Original Sequence 
(5')XXTAATGGCCATGGTAGTGATGGCCCAGATTGTGGCAAGGACTCCCTTGGTGGCAAGGAGAATAGCGAGAAAGTCAATATTGGGGC
XCTTGAGTGGAATTTCTACAAACACATaGGGAAAATCATTTTTTCCTTATCCTACATTTTATGXAGTAAAGTTTGCCTTCACGACACCAG
AGCAGTTTGGTGATGATTTGACTGAAGGTAATAATCAGGTTTTCCAGGTCGCAGAAACTGTTGCAGGGTTGACAAAGCAAGATAGAGTAG
CCCAACGCAAGCTGTTGTACTGTTTGAGTCTCTGTCCAATTTCGATTTTTCATAATACAGTTCAAGATGAATTTGGAATCAACAAGGGGA
ATGGGGTTTTTTTCCCTACTCAATCCCCCAGTGGTGAATATTTCAACTGGGTGGTGTAA\(3')TAGACGTGTACCCAAAGAGAGTGACA
ATCGCGGGGTGTTGATTGGCCTCCATGACAAGGTAATGTGGTTGCTGCCTCAAAAGCTGTTTGTTTCCTTTTGTCAAGTTTGTTATAACT
TGGTTTAAGAACTTGCTTATGTAATTTTATAGTCCCCATCATTTCGATCACAAATGCATTTTTTGCCCGTGTATATGTAAACTTTATTGG
ATTCAGTTTTATGCAATCATAATATTTTCATATTTTAACTAGGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGGAGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan