ESTScan Details for Unigene SGN-U264132

Score 
658
Direction 
Forward
Predicted Peptide Sequence 
KNGDISFFISLQFLFFTYPFLKNISTQFHYILFLKLLQEKGKMLASRSLGIVAATEGSVNKSSGKDEEKQEDPSVPTWAKPGTDEPPPWA
RNEAQKDSSSFQVPFIVYLLASAVTAIAAIGSIFEYTNQKPVFGVLGSDSVFYAPLLGFFVFTGIPTSAFLWFKSVQVANKEAEEQDRXG
W
Predicted Coding Sequence 
XXCAAAAATGGTGACATTAGCTTCTTCATCTCTCTGCAATTCCTCTTCTTCACTTATCCATTCCTCAAAAACATCTCTACCCAATTTCAT
TACATTCTCTTCCTCAAGTTATTACAAGAAAAGGGGAAAATGCTTGCAAGTCGTAGCCTTGGAATTGTAGCTGCTACTGAAGGCTCTGTT
AACAAATCCAGTGGAAAAGATGAAGAAAAACAAGAAGACCCATCAGTTCCTACATGGGCTAAACCCGGTACGGATGAGCCTCCACCATGG
GCTAGAAATGAAGCACAGAAAGATTCTTCAAGCTTTCAAGTTCCATTCATTGTTTATTTGCTTGCTTCTGCTGTCACAGCAATTGCAGCG
ATTGGTTCTATTTTCGAGTACACGAATCAGAAACCTGTGTTTGGAGTTTTGGGTTCAGATAGTGTTTTTTATGCTCCCTTGCTTGGGTTC
TTTGTTTTCACTGGCATTCCCACTTCTGCATTCCTTTGGTTCAAATCAGTACAAGTTGCTAACAAGGAGGCAGAGGAACAAGACCGCNAG
GGATGG\
Edits in Original Sequence 
(5')XXCAAAAATGGTGACATTAGCTTCTTCATCTCTCTGCAATTCCTCTTCTTCACTTATCCATTCCTCAAAAACATCTCTACCCAATT
TCATTACATTCTCTTCCTCAAGTTATTACAAGAAAAGGGGAAAATcGCTTGCAAGTCGTAGCCTTGGAATTGTAGCTGCTACTGAAGGCT
CTGTTAACAAATCCAGTGGAAAAGATGAAGAAAAACAAGAAGACCCATCAGTTCCTACATGGGCTAAACCCGGTACGGATGAGCCTCCAC
CATGGGCTAGAAATGAAGCACAGAAAGATTCTTCAAGCTTTCAAGTTCCATTCATTGTTTATTTGCTTGCTTCTGCTGTCACAGCAATTG
CAGCGATTGGTTCTATTTTCGAGTACACGAATCAGAAACCTGTGTTTGGAGTTTTGGGTTCAGATAGTGTTTTTTATGCTCCCTTGCTTG
GGTTCTTTGTTTTCACTGGCATTCCCACTTCTGCATTCCTTTGGTTCAAATCAGTACAAGTTGCTAACAAGGAGGCAGAGGAACAAGACC
GCNAGGGATGG\(3')ATATAATGTAACATCTAATATGCAATTTTTAGGTGATATCTGCAGCATCTTTATATGCATGTTCAGATGCTGCA
TGTAAGTGGGTTGTTTCCAAAGAAAATCATCATGGCAAAATGGATATTTCTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan