ESTScan Details for Unigene SGN-U264325

Score 
634
Direction 
Reverse
Predicted Peptide Sequence 
REKFGAWISSFASQEGIYDNLVKKLEEMAXTWMXGDPFDPDSHQGPQVDKKQYERVLSYIEHGKREGAKLLTGGNALDRKGYFIEPTIFI
DVEDDMTIAKEEIFGPVLAVMKFKTVEEVIKRANCTNYGLAAGVMTNDLNIANTVSRSIRAGVIWINCYFAFDPDCPYGGYKCSGFERDL
GMEGLHKYLQVKSVATPIYNSPWL
Predicted Coding Sequence 
AGGGAGAAATTTGGTGCCTGGATCTCGTCTTTTGCATCCCAAGAAGGTATTTACGACAACTTGGTCAAGAAATTGGAAGAGATGGCAANN
ACATGGATGNTTGGTGATCCTTTTGATCCCGATTCTCATCAAGGACCTCAAGTTGATAAAAAACAGTATGAGAGAGTACTTTCATACATT
GAACATGGCAAGAGGGAGGGTGCAAAATTGCTAACGGGGGGCAATGCATTGGATAGGAAGGGTTATTTCATTGAGCCAACCATATTTATT
GATGTTGAAGATGATATGACAATTGCAAAAGAAGAAATATTTGGACCTGTACTGGCAGTAATGAAGTTCAAGACGGTAGAGGAGGTGATC
AAGAGAGCTAACTGTACAAATTATGGACTAGCAGCAGGTGTGATGACCAATGACTTGAACATTGCTAACACAGTTTCAAGATCGATTCGA
GCTGGTGTTATCTGGATAAACTGTTACTTTGCTTTCGATCCAGATTGCCCATATGGAGGATACAAATGCAGTGGCTTTGAAAGGGATTTG
GGAATGGAAGGACTTCATAAGTATCTTCAAGTTAAATCTGTAGCCACTCCTATTTACAACTCTCCTTGGTTGTAA\
Edits in Original Sequence 
(5')AGGGAGAAATTTGtGTGCCTGGATCTCGTCTTTTGCATCCCAAGAAGGTATTTACGACAACTTGGTCAAGAAATTGGAAGAGATGG
CAANNACATGGATGNTTGGTGATCCTTTTGATCCCGATTCTCATCAAGGACCTCAAGTTGATAAAAAACAGTATGAGAGAGTACTTTCAT
ACATTGAACATGGCAAGAGGGAGGGTGCAAAATTGCTAACGGGGGGCAATGCATTGGATAGGAAGGGTTATTTCATTGAGCCAACCATAT
TTATTGATGTTGAAGATGATATGACAATTGCAAAAGAAGAAATATTTGGACCTGTACTGGCAGTAATGAAGTTCAAGACGGTAGAGGAGG
TGATCAAGAGAGCTAACTGTACAAATTATGGACTAGCAGCAGGTGTGATGACCAATGACTTGAACATTGCTAACACAGTTTCAAGATCGA
TTCGAGCTGGTGTTATCTGGATAAACTGTTACTTTGCTTTCGATCCAGATTGCCCATATGGAGGATACAAATGCAGTGGCTTTGAAAGGG
ATTTGGGAATGGAAGGACTTCATAAGTATCTTCAAGTTAAATCTGTAGCCACTCCTATTTACAACTCTCCTTGGTTGTAA\(3')ATTTG
CAGAAATCAAGTAGATTTTTACTATATGCCATAGTATCTCTCATGTTATACCATATGACTCAGAAAATAATTTTTTCTTGTTGTTTTGAT
GTCTTTGGATTTTGGGCTATAGAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan