ESTScan Details for Unigene SGN-U264493

Score 
268
Direction 
Forward
Predicted Peptide Sequence 
EASSPVWLWPFVALSIVCKHKPKMASSLSSLSTMLSQPHCAGASNSLNNIGQIPFFEASRSSINLLPPTPPHVSFSSEEFYILYQDIQEF
LAVSLTTSLTSKDQIPTLRDFIPKATQTVPASDVQQEPVMISDVIPRGRIYHETYGCQMNVNDMEIVLSIMKNAGYTESVEVPENAEIIF
INTCAIRDNAELKVWQRPIXFGFLKRQWKKHVASGKSQSAHPPKVVXAGX
Predicted Coding Sequence 
GAAGCCAGCTCGCCGGTTTGGTTGTGGCCATTCGTAGCCCTATCCATAGTCTGCAAACACAAACCAAAAATGGCGTCTTCTCTATCTTCT
CTATCAACCATGTTGAGCCAACCTCACTGTGCCGGCGCATCAAATTCCCTAAACAATATTGGTCAGATTCCTTTCTTCGAAGCTTCTAGA
AGTTCAATCAACCTCCTGCCGCCTACGCCGCCGCACGTCAGTTTCTCTTCGGAGGAGTTCTACATTCTCTATCAAGATATCCAGGAATTT
CTCGCAGTGTCACTCACCACTTCTTTAACCAGCAAGGACCAAATTCCAACCCTCCGCGATTTCATACCCAAAGCTACTCAGACTGTTCCT
GCTTCCGATGTTCAGCAGGAGCCTGTGATGATATCTGATGTTATCCCTAGAGGACGCATCTATCATGAAACTTATGGATGTCAAATGAAT
GTCAATGATATGGAGATTGTTTTATCCATCATGAAAAATGCTGGATACACTGAAAGTGTGGAAGTCCCAGAAAATGCTGAGATAATATTT
ATAAATACTTGTGCTATAAGGGACAATGCAGAACTTAAGGTTTGGCAGAGGCCAATTNATTTTGGGTTTCTXAAGAGGCAATGGAAGAAG
CATGTTGCCTCTGGAAAGTCACAGTCTGCACATCCCCCAAAAGTAGTTGXTGCTGGGGXX\
Edits in Original Sequence 
(5')GAAGCCAGCTCGCCGGTTTGGTTGTGGCCATTCGTAGCCCTATCCATAGTCTGCAAACACAAACCAAAAATGGCGTCTTCTCTATC
TTCTCTATCAACCATGTTGAGCCAACCTCACTGTGCCGtGCGCATCAAATTCCCTAAACAATATTcGGTCAGATTCCTTTCTTCGAAGCT
TCTAGAAGTTCAATCAACCTCCTGCCGCCTACGCCGCCGCACGTCAGTTTCTCTTCGGAGGAGTTCTACATTCTCTATCAAGATATCCAG
GAATTTCTCGCAGTGTCACTCACgCACTTCTTTAACCAGCAAGGACCAAATTCCAACCCTCCGCGATTTCATACCCAAAGCTACTCAGAC
TGTTCCTGCTTCCGATGTTCAGCAGGAGCCTGTGATGATATCTGATGTTATCCCTAGAGGACGCATCTATCATGAAACTTATGGATGTCA
AATGAATGTCAATGATATGGAGATTGTTTTATCCATCATGAAAAATGCTGGATACACTGAAAGTGTGGAAGTCCCAGAAAATGCTGAGAT
AATATTTATAAATACTTGTGCTATAAGGGACAATGCAGAACTTAAGGTTTGGCAGAGGCtCAATTNATTTTGGGTTTCTXAAGAGGCAAT
GGAAGAAGCATGTTGCCTCTGGAAAGTCACAGTCTGCACATCCCCCAAAAGTAGTTGXTGCTGGGGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan