ESTScan Details for Unigene SGN-U264616

Score 
236
Direction 
Forward
Predicted Peptide Sequence 
MVSKSSPPSPAPAPSLLRRIVDFDTAISLRLYTLTHPILPYYFLKTLEISGDGFLFFPLLLSLLLYPLAFSDSKNSNIFLINLLLGGILD
LIVIGPQNTLFGGPDPFTTKTCFSPLPSTIGPFPVDIHPEFPXIATLFYLSSDFIRDVLIQLQYDLIVDYLMLIVIGWAATTSCSRVLLG
RHFVFDVIAX
Predicted Coding Sequence 
ATGGTATCCAAGTCATCACCTCCGTCGCCGGCGCCGGCGCCGTCTTTGCTCCGCCGCATAGTCGATTTTGATACCGCCATCTCCCTCCGT
CTTTACACTCTAACTCACCCTATTCTCCCTTACTATTTCCTCAAAACCCTAGAGATCTCCGGTGACGGTTTCCTCTTCTTCCCTTTACTC
CTCTCACTACTCCTTTACCCTCTCGCTTTCTCCGATAGCAAAAATTCCAACATCTTCTTAATCAATTTACTCCTCGGTGGCATCCTTGAC
CTTATCGTAATCGGACCCCAAAACACCTTATTCGGAGGCCCCGACCCGTTTACAACAAAAACATGTTTCTCTCCTTTGCCGTCGACCATT
GGTCCTTTCCCAGTGGACATTCATCCAGAGTTTCCAXTGATTGCTACTCTCTTTTATCTATCATCCGATTTCATTCGGGATGTTTTGATT
CAGCTTCAATATGATTTAATTGTGGATTATTTGATGCTTATTGTCATCGGATGGGCCGCAACCACGTCGTGTTCCAGGGTACTTCTTGGA
CGGCATTTCGTATTCGATGTCATTGCTGXX\
Edits in Original Sequence 
GTTGGGCTTTAATTTTAACGAATTTCTGTCATTTCCACAAATCAGTTGGTTTCTACTAACACAAACTGGAACA(5')ATGGTATCCAAGT
CATCACCTCCGTCGCCGGCGCCGGCGCCGTCTTTGCTCCGCCGCATAGTCGATTTTGATACCGCCATCTCCCTCCGTCTTTACACTCTAA
CTCACCCTATTCTCCCTTACTATTTCCTCAAAACCCTAGAGATCTCCGGTGACGGTTTCCTCTTCTTCCCTTTACTCCTCTCACTACTCC
TTTACCCTCTCGCTTTCTCCGATAGCAAAAATTCCAACATCTTCTTAATCAATTTACTCCTCGGTGGCATCCTTGACCTTATCGTAATCG
GACCCCtAAAACACCTTATTCGGAGGCCCCGACCCGTTTACAACAAAAACATGTTTCTCTCCTTTGCCGTCGACCATTGGTCCTTTCCCA
GTGGACATTCATCCAGAGTTTCCAXTGATTGCTACTCTCTTTTATCTATCATCCGATTTCATTCGGGATGTTTTGATTCAGCTTCAATAT
GATTTAATTGTGGATTATTTGATGCTTATTGTCATCGGATGGGCCGCAACCACGTCGTGTTCCAGGGTACTTCTTGGACGGCATTTCGTA
TTCGATGTCATTGCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan