ESTScan Details for Unigene SGN-U264785

Score 
523
Direction 
Forward
Predicted Peptide Sequence 
VLDVHAPSHFPAFCLAAADQHSDAXSSSSSSSSQDHVSFIKDVAATQAPEHLNELLKILQVRGEEIISPGAKQGLVPLVIPLSRRSSDSV
TALLRWPTAPSGMEMPLVEVRKYGVWLLAKNVDQYIHRVLVEEDANGHQEKADELFRISAGAGKKLYEKGDFRAQKFQA
Predicted Coding Sequence 
XGGGTTTTGGATGTCCACGCGCCGTCGCATTTCCCGGCATTTTGTTTAGCCGCTGCCGACCAACATTCCGATGCTXATTCCTCTTCTTCT
TCTTCTTCTTCTCAAGACCATGTTTCATTTATCAAAGATGTAGCTGCAACTCAAGCACCGGAGCATTTGAATGAACTTCTCAAAATCCTT
CAGGTGAGAGGTGAGGAAATAATTTCTCCTGGTGCCAAACAAGGGCTGGTTCCTCTGGTGATTCCTCTTTCCAGAAGGAGTTCAGATTCT
GTAACTGCACTGTTACGATGGCCAACTGCCCCATCTGGGATGGAGATGCCGTTGGTAGAAGTGCGCAAGTATGGCGTGTGGCTATTAGCT
AAGAATGTAGATCAGTACATTCACAGGGTTTTGGTGGAAGAAGATGCAAATGGTCATCAAGAAAAAGCGGATGAATTGTTCCGGATTTCA
GCTGGTGCTGGAAAGAAACTTTATGAGAAGGGTGATTTTAGAGCTCAAAAATTTCAAGCGTAG\
Edits in Original Sequence 
(5')XGGGTTTTGGATGTCCACGCGCCGTCGCATTTCCCGGCATTTTGTTTAGCCGCTGCCGACCAACATTCCGATGCTXATTCCTCTTC
TTCTTCTTCTTCTTCTCAAGACCATGTTTCATTTATCAAAGATGTAGCTGCAACTCAAGCACCGGAGCATTTGAATGAACTTCTCAAAAT
CCTTCAGGTGAGAGGTGAGGAAATAATTTCTCCTGGTGCCAAACAAGGGCTGGTTCCTCTGGTGATTCCTCTTTCCAGAAGGAGTTCAGA
TTCTGTAACTGCACTGTTACGATGGCCAACTGCCCCATCTGGGATGGAGATGCCGTTGGTAGAAGTGCGCAAGTATGGCGTGTGGCTATT
AGCTAAGAATGTAGATCAGTACATTCACAGGGTTTTGGTGGAAGAAGATGCAAATGGTCATCAAGAAAAAGCGGATGAATTGTTCCGGAT
TTCAGCTGGTGCTGGAAAGAAACTTTATGAGAAGGGTGATTTTAGAGCaTCAAAAATTTCAAGCGTAG\(3')ATACATATATATTGAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan