ESTScan Details for Unigene SGN-U265129

Score 
119
Direction 
Forward
Predicted Peptide Sequence 
RKPMTGEPALHLAVIGNIHSEPCGVPYDXSDILMSIPRDKDGMTPLDILKQQPPSASSELLTKQLISAGGIFSHHDYSARRVVASHLKMQ
NINSSPGTSFRISDHLKYSYIPGIDMPSDGSRNAGLSHPCTSPDTFCSTNGKKPGSPNDAAQKLKRFFHWPKIKKRD
Predicted Coding Sequence 
XCGAGGAAACCAATGACCGGTGAACCTGCTCTTCATTTGGCTGTCATTGGAAATATTCATTCTGAACCTTGTGGAGTTCCTTATGACXTG
TCCGATATATTAATGTCAATACCTCGTGATAAGGATGGAATGACACCACTTGATATCCTGAAGCAACAGCCACCTTCTGCTTCATCAGAG
CTACTTACAAAGCAGTTGATATCTGCAGGGGGGATTTTCAGTCATCACGATTATTCTGCAAGAAGAGTTGTTGCATCCCATTTAAAGATG
CAAAATATAAATAGCAGTCCTGGAACTTCTTTTAGAATCTCGGACCACCTGAAATATTCTTATATACCTGGCATTGACATGCCATCAGAT
GGCAGTAGAAATGCTGGGCTGAGTCATCCCTGCACGAGTCCTGATACCTTTTGTTCTACAAATGGTAAGAAACCTGGTTCCCCAAATGAT
GCAGCACAAAAACTGAAACGCTTCTTCCATTGGCCAAAAATTAAGAAAAGAGAT\
Edits in Original Sequence 
(5')XCGAGGAAACCAATGACCGGTaGAACCTGCTCTTCATTTGGCTGTCATTGGAAATATTCATTCTGAACCTTGTGGAGTTaCCTTAT
GACXTGTCCGATATATTAATGTCAATACCTCGTGATAAGGATGGAATGACACCAcCTTGATATCCTGAAGCAACAGCCACCgTTCTGCTT
CATCAGAGCTACTTACAAAGCAGTTGATATCTGCAGGGGGGATTTTCAGTCATCACGATTATTCTGCAAGAAGAGTTGTTGCATCCCATT
TAAAGATGCAAAATATAAATAGCAGTCCTGGAACTTCTTTTAGAATCTCGGACCACCTGAAATATTCTTATATACCTGGCATTGaACATG
CCATCAGATGGCAGTAGAAATGCTGGGCTGAGTCATCCCTGCACGAGTCCTGATACCTTTTGTTCTACAAATGGTAAGAAACCTGGTTCC
CCAAATGATGCAGCACAAAAACTGAAACGCTTCTTCCATTGGCCAAAAATTAAGAAAAGAGAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan