ESTScan Details for Unigene SGN-U265252

Score 
358
Direction 
Forward
Predicted Peptide Sequence 
ELEGSPRGTKSLVEFNKTWENTKRSNENPEIQTPTHGLSLKEAISASISRGKLVSGTTSDIHTSPASMVPTYANPFWIEMLVLSKRSFTN
SWRVPELFGIRLGAIVVTGFILATMFWQLDDSPKGVQERLGFFAFAMSTTFYTCADALPVFLQERYIFMRETAYNAYRRSSYCLSHAIVS
LPALIFLSFAFAAITFWAVGLVGGFSGLFVLFRDNTTSFWGGXSFVTFX
Predicted Coding Sequence 
XGCGAACTAGAAGGGTCCCCTCGAGGGACAAAAAGTTTGGTTGAGTTCAACAAAACATGGGAAAATACTAAAAGGAGTAATGAAAATCCT
GAAATCCAAACACCTACTCATGGATTGTCATTGAAAGAAGCAATTAGCGCGAGTATTTCAAGAGGGAAGTTGGTTTCAGGGACAACGAGT
GATATTCATACTAGTCCAGCATCAATGGTTCCAACTTACGCGAATCCATTTTGGATTGAAATGCTTGTGTTGTCCAAGAGATCATTTACG
AATTCTTGGAGGGTGCCAGAGTTATTTGGTATTCGTCTAGGGGCAATCGTGGTCACGGGGTTCATCCTAGCTACCATGTTTTGGCAACTT
GATGATTCCCCTAAAGGGGTTCAAGAAAGGCTTGGTTTCTTTGCATTTGCTATGTCAACAACTTTCTATACTTGCGCGGACGCGTTGCCT
GTGTTTCTCCAAGAGAGGTACATTTTCATGAGGGAGACTGCTTATAATGCTTATAGGAGATCTTCCTATTGTCTATCTCATGCTATAGTT
TCTTTGCCAGCATTGATCTTTCTTAGCTTTGCATTTGCTGCTATAACTTTTTGGGCTGTAGGCCTTGTAGGTGGATTTTCXGGGCTTTTT
GTTCTATTTCGCGATAATACTACCTCCTTCTGGGGCGGGAANTCATTTGTCACGTTCCXX\
Edits in Original Sequence 
(5')XGCGAACTAGAAGGGTCCCCTCGAGGGACAAAAAGTTTGGTTGAGTTCAACAAAACATGGGAAAATACTAAAAGGAGTAATGAAAA
TCCTGAAATCCAAACACCTACTCATGGATTGTCATTGAAAGAAGCAATTAGCGCGAGTATTTCAAGAGGGAAGTTGGTTTCAGGGACAAC
GAGTGATATTCATACTAGTCCAGCATCAATGGTTCCAACTTACGCGAATCCATTTTGGATTGAAATGCTTGTGTTGTCCAAGAGATCATT
TACGAATTCTTGGAGGGTGCCAGAGTTATTTGGTATTCGTCTAGGGGCAATCGTGGTCACGGGGTTCATCCTAGCTACCATGTTTTGGCA
ACTTGATGATTCCCCTAAAGGGGTTCAAGAAAGGCTTGGTTTCTTTGCATTTGCTATGTCAACAACTTTCTATACTTGCGCGGACGCGTT
GCCTGTGTTTCTCCAAGAGAGGTACATTTTCATGAGGGAGACTGCTTATAATGCTTATAGGAGATCTTCCTATTGTCTATCTCATGCTAT
AGTTTCTTTGCCAGCATTGATCTTTCTTAGCTTTGCATTTGCTGCTATAACTTTTTGGGCTGTAGGCCTTGTAGGTGGATTTTCXGGGCT
TTTTGTTCTATTTCGCGATAATACTAgCCTCCTTCTGGGGCGGGAANTCATTTGTCACGTTCCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan