ESTScan Details for Unigene SGN-U265711

Score 
218
Direction 
Forward
Predicted Peptide Sequence 
RRKPPFSATGKMAGKSTADLHYNHTRLVLKYAXHFKARPNLPNSSMEINAQPLRYLRFDXTLAASPTPXSIIGLFSGSNFYSKPDSPPFL
LPRLASVIEDSIVWDSVYFVRIAQCGYEYEQNYAFFPXDSDLHLFAFTNRACPIDPFIGQRAVLGLSGYVLNNFAFVLASFYLYRLSAII
LKDSEVALRATILFCLNPASIFYSSIYTESMYA
Predicted Coding Sequence 
CGCCGTAAACCTCCTTTCTCCGCCACCGGGAAAATGGCCGGAAAATCCACCGCCGATCTCCATTATAACCACACTCGTCTCGTTCTCAAA
TACGCCGXTCATTTCAAGGCTCGTCCTAATCTCCCTAATAGTTCTATGGAGATCAATGCTCAGCCCTTACGATACCTCCGGTTCGATAAX
ACCCTAGCTGCCTCTCCAACACCAXCGTCCATTATCGGTTTGTTTTCCGGTTCAAATTTTTACTCGAAACCCGACTCGCCGCCCTTTCTC
CTCCCGCGATTGGCATCGGTGATCGAGGATAGCATTGTTTGGGATAGTGTGTACTTTGTACGAATTGCGCAGTGTGGATATGAGTATGAA
CAGAACTACGCCTTTTTTCCTXCTGATTCCGATTTGCATCTCTTTGCTTTCACGAACCGTGCTTGCCCCATTGATCCTTTTATTGGACAG
AGAGCTGTTCTTGGATTATCTGGTTATGTGCTTAATAACTTTGCATTTGTTTTGGCTTCTTTTTATCTTTACAGGCTCTCAGCTATTATC
TTGAAGGATTCCGAGGTGGCATTGAGAGCTACAATATTGTTTTGCCTTAATCCCGCCTCTATATTCTACTCATCAATATATACTGAGAGT
ATGTATGCT\
Edits in Original Sequence 
(5')CGCCGTAAACCTCCTTTCTCCGCCACCGGGAAAATGGCCGGAAAATCCACCGCCGATCTCCATTATAACCACACTCGTCTCGTTCT
CAAATACGCCGXTCATTTCAAGGCTCGTCCTAATCTCCCTAATAGTTCTATGGAGATCAATGCTCAGCCCTTACGATACCTCCGGTTCGA
TAAXACCCTAGCTGCCTCTCCAACACCAXCGTCCATTATCGGTTTGTTTTCCGGTTCAAATTTTTACTCGAAACCCGACTCGCCGCCCTT
TCTCCTCCCGCGATTGGCATCGGTGATCGAGGATAGCATTGTTTGGGATAGTGTGTACTTTGTACGAATTGCGCAGTGTGGATATGAGTA
TGAACAGAACTACGCCTTTTTTCCTXCTGATTCCGATTTGCATCTCTTTGCTTTCACGAACCGTGCTTGCCCCATTGATaCCTTTTATTG
GACAGAGAGCTGTTCTTGGATTATCTGGTTATGTGCTTAATAACTTTGCATTTGTTTTGGCTTCTTTTTATCTTTACAGGCTCTCAGCTA
TTATCTTGAAGGATTCCGAGGTGGCATTGAGAGCTACAATATTGTTTTGCCTTAATCCCGCCTCTATATTCTACTCATCAATATATACTG
AGAGTATGTATGCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan