ESTScan Details for Unigene SGN-U266059

Score 
603
Direction 
Forward
Predicted Peptide Sequence 
GVDSPSMFGSLDDDSRGKSTNRHRRISDPTIGRMQGNAWKGVPNWQSPLANGFMPFQHGPPPVGFHPAMQQFPGPPMFGVRPSMELSHPG
VPYHMPDADRFSGHGRPMGWRTPLDDSCGPPLHGWDANNFGEEAHLYGRPDWDQNRTLSNNSRSWETIGDVWKGPIRGTSVELPSGSQKE
VCSIQAPDNSFAAQLAQQALGEQKKTDQDTXKAMISVFSPAVSWKEHSRRLKINHEELPIDVESSGKEEVSLSNVTFKX
Predicted Coding Sequence 
XCTGGGGTTGACAGCCCATCAATGTTTGGCTCTTTGGACGACGACAGTAGAGGGAAGTCAACCAACCGTCACAGAAGAATTAGTGATCCT
ACTATAGGAAGAATGCAAGGAAATGCTTGGAAGGGGGTTCCAAATTGGCAGTCACCTCTGGCAAATGGTTTCATGCCTTTCCAGCATGGT
CCACCTCCTGTTGGTTTTCATCCCGCAATGCAGCAGTTTCCCGGACCACCAATGTTCGGTGTTAGGCCTTCAATGGAATTGAGTCACCCT
GGGGTTCCTTACCATATGCCAGATGCAGACCGCTTTTCTGGCCATGGGCGCCCAATGGGTTGGCGAACTCCACTAGATGATTCATGCGGT
CCCCCATTGCATGGGTGGGATGCTAACAATTTTGGTGAAGAAGCTCACCTTTATGGAAGGCCAGACTGGGACCAGAATAGGACTTTGTCC
AACAATAGTCGGAGTTGGGAGACAATTGGTGATGTATGGAAAGGGCCAATAAGGGGCACCAGTGTGGAGCTGCCATCTGGTTCACAGAAG
GAGGTCTGTTCAATTCAGGCCCCAGATAATTCTTTTGCTGCTCAGTTGGCTCAGCAAGCTCTGGGTGAGCAAAAGAAGACAGATCAAGAT
ACTGXAAAAGCAATGATATCAGTTTTCAGTCCAGCAGTGTCCTGGAAGGAGCACTCTAGAAGATTGAAAATTAATCATGAAGAGCTACCA
ATTGATGTTGAGTCATCAGGGAAAGAAGAAGTAAGTCTTAGCAATGTTACCTTCAAAAAX\
Edits in Original Sequence 
(5')XCTGGGGTTGACAGCCCATCAATGTTTGGCTCTTTGGACGACGACAGTAGAGGGAAGTCAACCAACCGTCACAGAAGAATTAGTGA
TCCTACTATAGGAAGAATGCAAGGAAATGCTTGGAAGGGGGTTCCAAATTGGCAGTCACCTCTGGCAAATGGTTTCATGCCTTTCCAGCA
TGGTCCACCTCCTGTTGGTTTTCATCCCGCAATGCAGCAGTTTCCCGGACCACCAATGTTCGGTGTTAGGCCTTCAATGGAATTGAGTCA
CCCTGGGGTTCCTTACCATATGCCAGATGCAGACCGCTTTTCTGGCCATGGGCGCCCAATGGGTTGGCGAACTCCACTAGATGATTCATG
CGGTCCCCCATTGCATGGGTGGGATGCTAACAATTTTGGTGAAGAAGCTCACCTTTATGGAAGGCCAGACTGGGACCAGAATAGGACTTT
GTCCAACAATAGTCGGAGTTGGGAGACAATTGGTGATGTATGGAAAGGGCCAATAAGGGGCACCAGTGTGGAGCTGCCATCTGGTTCACA
GAAGGAGGTCTGTTCAATTCAGGCCCCAGATAATTCTTTTGCTGCTCAGTTGGCTCAGCAAGCTCTGGGTGAGCAAAAGAAGACAGATCA
AGATACTGXAAAAGCAATGATATCAGTTTTCAGTCCAGCAGTGTCCTGGAAGGAGCACTCTAGAAGATTGAAAATTAATCATGAAGAGCT
ACCAATTGATGTTGAGTCATCAGGGAAAGAAGAAGTAAGTCTTAGCAATGTTACCTTCAAAAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan