Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U266402

Score 
662
Direction 
Forward
Predicted Peptide Sequence 
LSPTSLSPPATPGFSVTPLLSTSLYKNGTQIHFAHKQTCTPLFLDTINPDVVQTSKNGGFQTISDFNHQLASLVLEDEFELALKLTSSSS
FYALTPNEYTYSIWVNLYCKKDDPETAKSILGHMLEHGFQPKVETFTTLINSFCKAGKLQQAHQVFDVMGQIGCEPTIHTYNCLLKGLSF
LGRVEEAYDLLMNIKKSKIKPDLYTYTAVMDGFCKVGRSNEALELLEEAMEMGLTP
Predicted Coding Sequence 
CTCTCCCCTACCAGTCTCTCCCCACCAGCAACACCTGGTTTCTCTGTTACGCCTCTACTATCCACTTCTCTATACAAAAATGGAACCCAG
ATTCACTTTGCTCACAAACAAACTTGCACTCCTCTATTTCTTGATACTATTAATCCAGATGTTGTTCAAACTTCAAAAAATGGTGGGTTT
CAAACCATATCTGATTTCAATCATCAACTTGCATCTTTAGTTTTAGAAGATGAGTTTGAGCTAGCTTTGAAACTGACCTCATCTTCATCA
TTTTATGCATTGACACCCAATGAATACACATACTCAATTTGGGTCAATTTGTACTGCAAAAAAGATGACCCTGAAACAGCCAAATCCATT
TTAGGTCACATGTTGGAACATGGGTTTCAACCAAAAGTTGAAACTTTTACAACTCTCATCAATTCATTCTGCAAAGCTGGAAAATTACAA
CAAGCCCATCAGGTTTTTGATGTTATGGGTCAAATTGGATGTGAACCCACAATTCATACTTACAATTGCTTGCTTAAAGGTCTTTCTTTT
CTTGGTAGAGTAGAGGAAGCCTATGACTTGCTTATGAATATCAAGAAATCTAAGATAAAACCTGATCTGTATACTTATACTGCTGTTATG
GATGGTTTCTGTAAGGTGGGTAGGTCCAATGAGGCATTGGAATTGCTTGAAGAAGCTATGGAAATGGGGTTGACCCCT\
Edits in Original Sequence 
(5')CTCTCCCCTACCAGTCTCTCCCCtACCAGCAACACCTGGTTTCTCTGTTACGCCTCTACTATCCACTTCTCTATACAAAAATGGAA
CCCAGATTCACTTTGCTCACAAACAAACTTGCACTCCTCTATTTCTTGATACTATTAATCCAGATGTTGTTCAAACTTCAAAAAATGGTG
GGTTTCAAACCATATCTGATTTCAATCATCAACTTGCATCTTTAGTTTTAGAAGATGAGTTTGAGCTAGCTTTGAAACTGACCTCATCTT
CATCATTTTATGCATTGACACCCAATGAATACACATACTCAATTTGGGTCAATTTGTACTGCAAAAAAGATGACCCTGAAACAGCCAAAT
CCATTTTAGGTCACATGTTGGAACATGGGTTTCAACCAAAAGTTGAAACTTTTACAACTCTCATCAATTCATTCTGCAAAGCTGGAAAAT
TACAACAAGCCCATCAGGTTTTTGATGTTATGGGTCAAATTGGATGTGAACCCACAATTCATACTTACAATTGCTTGCTTAAAGGTCTTT
aCTTTTCTTGGTAGAGTAGAGGAAGCCTATGACTTGCTTATGAATATCAAGAAATCTAAGATAAAACCTGATCTGTATACTTATACTGCT
GTTATGGATGGTTTCTGTAAGGTGGGTAGGTCCAATGAGGCATTGGAATTGCTTGAAGAAGCTATGGAAATGGGGTTGACCCCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan