ESTScan Details for Unigene SGN-U267372

Score 
97
Direction 
Forward
Predicted Peptide Sequence 
MHFPXNEPSLIEKHSTEGLQFAPSPIALACIYVLVYQMHVPLRFYAPIPMHPIMNHIEAGNTRSYQKALCAQSFPPEMCQLPX
Predicted Coding Sequence 
ATGCATTTTCCCATXAATGAACCATCTCTAATTGAGAAGCATTCCACAGAGGGTCTGCAGTTTGCGCCTTCTCCAATTGCTCTCGCGTGT
ATATATGTTCTCGTTTATCAGATGCATGTTCCATTAAGGTTTTACGCGCCCATTCCCATGCACCCAATAATGAATCATATTGAGGCTGGT
AATACCAGAAGTTATCAAAAAGCTCTCTGCGCACAATCATTTCCTCCAGAAATGTGTCAACTGCCTGXX\
Edits in Original Sequence 
CACCTTTTTTTAGGAATGACCGTCCAATGTATTCTCATTTTAGTTTGTTCAAAAAGGATCTATATACTGAGGTCTATAAGGTTCATAGTT
ACAAGAGAAATAAAAAGGTTAGTTACTAAACAATTATCAATCTCTGCAAAATCCAGGCGTACATGACTTTTGATGACATTAATAAAGCCT
TTCAATAATGCTAATTACGCAATTCTTTTGCCTTTTTGTCCAAAATTACTTCTCCTTTTCTTTTCTTGCTTTCACCTACTAGCCTCTTAA
CGTATGAAATATATCCCTCCACGTTAAACTTCCTCTTGCAACCTGCGTAGTTCATGTACCTGATTTTCCCAAATACCGGGCGCTCTCGCC
AACCCTGGTCGTGTACGCCACATATTGACCACATGCATCCAACATAACCACTAGGATCTCTACCATCTATATGATACTTATCATTTAAAT
ATATTGTGATAGCCAGAGCTTCTTCTGGTCCATTTGTCCATTCGAGTATCTTTTTAGCCCAATACATCCTCATAAAACC
(5')ATGCATT
TTCCCATXAATGAACCATCTCTAATTGAGAAGCATTCCACAGAGGGTCTGCAGTTTGCGCCTTCTCCAATTGCTCTCGCGTGTATATATG
TTCTCGTTTATCAGATGCATGTTCCATTAAGGTTTTACGCGCCCATTCCCATGCACCCAATAATGAATCATATTGAGGCTGGTAATACCA
GAAGTTATCAAAAAGCTCTCTGCGCACAATCATTTCCTCCAGAAATGTGTCAACTGCCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan