Notice: The SGN server upgrade is complete. Please let us know if you find any issues. :-)

ESTScan Details for Unigene SGN-U267425

Score 
430
Direction 
Forward
Predicted Peptide Sequence 
MGVVIIDGSTIRDFVNDEAAFTKSIDKGFTDLDLNNDGVLSRSELRKAFESLHLIESHFGVDVAATPEELTDLYDSIFEKFDCDHNGTVD
REEFGNEMRKIMLAIADGLGSSPIQMALDDSEESLIKQAADLEASKLPA
Predicted Coding Sequence 
ATGGGTGTGGTGATCATCGACGGATCAACAATTCGGGACTTCGTTAACGACGAAGCTGCTTTCACAAAGTCAATTGATAAGGGATTTACC
GATTTGGACCTGAATAACGACGGCGTTTTGTCTCGATCCGAGCTCCGCAAAGCCTTTGAATCTCTCCATCTCATTGAATCTCACTTCGGC
GTCGACGTCGCCGCCACGCCGGAGGAACTCACCGACCTCTATGATTCCATATTCGAGAAGTTTGATTGCGACCACAACGGCACTGTCGAT
CGAGAGGAATTTGGAAATGAGATGAGGAAAATTATGCTGGCGATCGCGGATGGACTTGGTTCATCGCCGATTCAAATGGCGCTTGATGAT
AGTGAAGAGAGTTTGATCAAGCAAGCTGCTGATCTCGAAGCTTCTAAGCTTCCTGCCTAG\
Edits in Original Sequence 
TAATTCCCCAACCATAAATCCTATTCCAATTTCCCCATAATCAGTAGAACAATGTCTCAAACACTTGAAAAAATTAAATAAAA(5')ATG
GGTGTGGTGATCATCGACGGATCAACAATTCGGGACTTCGTTAACGACGAAGCTGCTTTCACAAAGTCAATTGATAAGGGATTTACCGAT
TTGGACCTGAATAACGACGGCGTTTTGTCTCGATCCGAGCTCCGCAAAGCCTTTGAATCTCTCCATCTCATTGAATCTCACTTCGGCGTC
GACGTCGCCGCCACGCCGGAGGAACTCACCGACCTCTATGATTCCATATTCGAGAAGTTTGATTGCGACCACAACGGCACTGTCGATCGA
GAGGAATTTGGAAATGAGATGAGGAAAATTATGCTGGCGATCGCGGATGGACTTGGTTCATCGCCGATTCAAATGGCGCTTGATGATAGT
GAAGAGAGTTTGATCAAGCAAGCTGCTGATCTCGAAGCTTCTAAGCTTCCTGCCTAG\(3')TATACATATATAACCAACCGCTTTCGAA
TAAGTTCCTCTTTTGTTGTTTAATTTCAACTTTCACATCTCCATGTGGTGTGGTCAGTTATGTATTTTAACTTCCTAATTTACTAGTTTT
TATATATATGCAATTTGCTGGTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan