ESTScan Details for Unigene SGN-U267735

Score 
423
Direction 
Forward
Predicted Peptide Sequence 
LLHYLVSVLEGDFVPRNKAFKXKDELDPFAGFIAQHASGVKKNNLKSLVKDCLSVICDVFSDLYDKSESSSDVDSVAPPSNEISHNCIAA
FALALPELKXDYLYLSEEFPENDDGAGSSRNVADVQGLTTRVDGXECRSPAAEIILDELAYNSDMLSPFFQVFDDPWWKLKMIM
Predicted Coding Sequence 
XTACTACTTCACTATCTTGTTAGTGTGCTTGAAGGAGACTTTGTGCCGCGTAACAAAGCATTCAAAGAXAAAGATGAGTTGGACCCTTTT
GCGGGATTCATTGCTCAACATGCTTCTGGGGTCAAGAAAAATAATCTTAAAAGCTTAGTCAAGGACTGCCTGTCGGTTATATGTGATGTG
TTCTCTGACTTATATGATAAATCTGAGTCCTCCTCTGATGTGGATTCAGTGGCACCTCCTTCAAACGAGATATCACATAATTGCATTGCT
GCTTTTGCACTGGCTTTACCTGAACTCAAACXGGACTACTTGTATCTATCTGAAGAATTTCCTGAGAATGATGATGGAGCTGGATCATCG
CGGAATGTGGCAGATGTTCAAGGCCTTACCACCAGAGTTGATGGTGXTGAGTGCAGATCACCTGCTGCAGAGATCATTTTGGATGAACTC
GCTTACAATTCTGATATGCTCTCCCCCTTTTTTCAGGTCTTTGATGACCCTTGGTGGAAGCTAAAAATGATCATG\
Edits in Original Sequence 
(5')XTACTACTTCACTATCTTGTTAGTGTGCTTGAAGGAGACTTTGTGCCGCGTAACAAAGCATTCAAAGAXAAAGATGAGTTGGACCC
TTTTGCGGGATTCATTGCTCAACATGCTTCTGGGGTCAAGAAAAATAATCTaTAAAAGCTTAGTCAAGGACTGCCTGTCGGTTATATGTG
ATGTGTTCTCTGACTTATATGATAAATCTGAGTCCTCCTCTGATGTGGATTCAGTGGCACCTCCTTCAAACGAGATATCACATAATTGCA
TTGCTGCTTTTGCACTGGCTTTACCTGAACTCAAACXGGACTACTTGTATCTATCTGAAGAATTTCCTGAGAATGATGATGGAGCTGGAT
aCATCGCGGAATGTGGCAGATGTTCAAGGCCTTACCACCAGAGTTGATGGTGXTGAGTGCAGATCACCTGCTGCAGAGATCATTTTGGAT
GAACTCGCTTACAATTCTGATATGCTCTCCCCCTTTTTTCAGGTCTTTGATGACCCTTGGTGGAAGCTAAAAATGATCATG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan