ESTScan Details for Unigene SGN-U268015

Score 
698
Direction 
Forward
Predicted Peptide Sequence 
EQDALASNECEEHDEFKSRIGSIKEYQSPSPQPLPLPSPQSAAATLKTMGSFKVGNASGPLNASGPLPLPPTLPSTLPSTGALRNFSFEE
LAAACHRFSPERCMSEGLSSVIYRASFGDDATGTKKLEATVTRLHPSSQGLKEFVTEVNTLASLQHPSLCKLIGFHAREGSEHRMLVYER
LFHGSLDRLLFGRSDGPPIDWNARTKIALCAAQGLTFLHXEGPFQAMFHEFSTANIQIDKDCSAKLSGYGCITXIXETDISCSSAALANL
S
Predicted Coding Sequence 
GAACAAGATGCGCTAGCATCAAATGAATGTGAGGAACATGATGAGTTCAAGAGTCGTATTGGTTCAATCAAGGAGTACCAATCACCAAGT
CCTCAGCCTCTTCCTCTTCCATCTCCACAGAGTGCCGCTGCCACTCTCAAGACTATGGGAAGCTTTAAAGTTGGCAACGCCAGCGGTCCG
TTAAATGCCTCTGGACCCCTGCCACTGCCTCCTACACTGCCTTCAACATTGCCTTCTACTGGAGCACTCAGGAACTTCTCATTTGAAGAA
CTTGCTGCTGCCTGCCACCGCTTCTCTCCTGAACGGTGTATGTCAGAAGGTCTCTCTTCTGTTATTTACAGAGCTTCTTTTGGAGATGAT
GCAACTGGTACAAAGAAGCTTGAAGCCACTGTAACCCGGCTTCATCCTTCTTCGCAGGGGTTGAAGGAATTTGTGACTGAGGTGAACACA
CTAGCTTCTTTGCAACATCCATCACTTTGTAAACTGATTGGTTTCCATGCACGGGAAGGTTCCGAGCACAGAATGTTGGTTTATGAAAGG
CTTTTTCATGGAAGCTTAGACCGGCTTTTGTTTGGGAGGTCCGATGGTCCCCCGATAGACTGGAATGCTCGAACGAAAATTGCTTTATGT
GCTGCTCAAGGTCTCACATTCCTGCATGANGAAGGACCTTTTCAGGCAATGTTCCATGAATTTTCCACTGCAAATATACAAATTGATAAG
GATTGCAGTGCAAAGCTCTCGGGATATGGATGCATTACTCNTATACNAGAGACAGACATATCATGCAGTTCAGCTGCCCTGGCAAATCTC
TCX\
Edits in Original Sequence 
(5')GAACAAGATGCGCTAGCATCAAATGAATGTGAGGAACATGATGAGTTCAAGAGTCGTATTGGTTCAATCAAGGAGTACCAATCACC
AAGTCCTCAGCCTCTTCCTCTTCCATCTCCACAGAGTGCCGCTGCCACTCTCAAGACTATGGGAAGCTTTAAAGTTGGCAACGCCAGCGG
TCCGTTAAATGCCTCTGGACCCCTGCCACTGCCTCCTACACTGCCTTCAACATTGCCTTCTACTGGAGCACTCAGGAACTTCTCATTTGA
AGAACTTGCTGCTGCCTGCCACCGCTTCTCTCCTGAACGGTGTATGTCAGAAGGTCTCTCTTCTGTTATTTACAGAGCTTCTTTTGGAGA
TGATGCAACTGGTACAAAGAAGCTTGAAGCCACTGTAACCCGGCTTCATCCTTCTTCGCAGGGGTTGAAGGAATTTGTGACTGAGGTGAA
CACACTAGCTTCTTTGCAACATCCATCACTTTGTAAACTGATTGGTTTCCATGCACGGGAAGGTTCCGAGCACAGAATGTTGGTTTATGA
AAGGCTTTTTCATGGAAGCTTAGACCGGCTTTTGTTTGGGAGGTCCGATGGTCCCCCGATAGACTGGAATGCTCGAACGAAAATTGCTTT
ATGTGCTGCTCAAGGTCTCACATTCCTGCATGANGAAGGACCTTTTCAGGCAATGTTCCATGAATTTTCCACTGCAAATATACAAATTGA
TAAGGATTGCAGTGCAAAGCTCTCGGGATATGGATGCATTACTCNTATACNAGAGACAGACATATCATGCAGTTCAGCTGCCCTGGCAAA
TCTCTCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan