ESTScan Details for Unigene SGN-U268149

Score 
136
Direction 
Forward
Predicted Peptide Sequence 
IAIREAWLKLSLSNNMGIKATVLCEALGFYCLPMIDVGHPSSEPRFQSHKLISKQKFNFAPATFINLKVWLNADESNGCDDLGIFRFIFR
VKVEKRLSRNKKAQELALQHLLKXVIDGLVPLTEMSNCVSKAXQGMTKERASYIMQLAKFDVPQYIQINLPKRRKQQLLSQPAFKFESTN
LKIEFKSVCEAVVNISLCFERPAX
Predicted Coding Sequence 
ATAGCGATTAGGGAGGCATGGCTCAAGCTCTCTCTGTCAAACAACATGGGGATAAAAGCAACAGTTTTGTGTGAAGCTCTAGGTTTCTAC
TGTTTGCCGATGATTGACGTTGGGCATCCATCGTCTGAACCTCGGTTCCAGTCTCATAAGCTTATCAGCAAACAAAAATTTAATTTTGCA
CCCGCCACTTTCATAAACCTGAAGGTATGGCTAAATGCTGATGAATCAAATGGTTGTGATGATCTCGGCATTTTTCGGTTCATCTTTAGA
GTTAAAGTTGAAAAGAGATTGTCAAGGAATAAGAAGGCGCAAGAGTTGGCTCTGCAACATTTACTTAAAXCTGTGATTGATGGTTTAGTT
CCATTAACAGAGATGTCCAATTGTGTTAGTAAAGCTXTGCAGGGAATGACAAAGGAGCGTGCATCGTACATTATGCAATTAGCCAAATTT
GATGTCCCTCAATACATACAAATTAACTTACCAAAAAGGAGGAAGCAGCAGTTGCTTAGTCAGCCAGCTTTCAAATTTGAATCCACAAAC
TTAAAAATAGAGTTCAAATCTGTCTGTGAAGCTGTCGTCAACATTTCTCTTTGTTTCGAAAGACCTGCGCAX\
Edits in Original Sequence 
TCCTTACTTTTTCCTGTTTATCTACACACTTTAAATCTGTCTCTCAAGCTTTCCTGAAGATCTCTGTTTGTTTCGGACGACCTGCGCAGC
TGCTTCTTCATGCTTTAAGTTTCTCACCTCCTTGAGTTTCAAATCTGTCTGTGAAGCTGTCGTCAATATTTCTTTTTGTTTCGAAAGACC
TGCGCAGGTAATTTTTTCTCTCAATTTTTGCATTAATCCTCTTACAATTCTTTACAAGTTCCTCAACTTAGAGAAAGGGCTGGAGTTTTG
GGAGGATTTTTTAGGAACAAACATATTATTGAATCCATTTTTGATTATGTTCCAGTGGATTCAAGACCCGATTCCTCTATCTTTGTATTT
GCAAAATCTATAGTTTTTATGTGATTATA
(5')ATAGCGATTAGGGAGGCATGGCTCAAGCTCTCTCTGTCAAACAACATGGGGATAAAA
GCAACAGTTTTGTGTGAAGCTCTAGGTTTCTACTGTTTGCCGATaGATTGACGTTGGGCATCCATCGTCTGAACCTCGGTTCCAGTCTCA
TAAGCTTATCAGCAAACAAAAATTTAATTTTGCACCCGCCACTTTCATAAACCTGAAGGTATGGCTAAATGCTGATGAATCAAATGGTTG
TGaATGATCTCGGCATTTTTCGGTTCATCTTTAtGAGTTAAAGTTGAAAAGAGATTGTCAAGGAATAAGAAGGCGCAAGAGTTGGCTCTG
CAACATTTACTTAAAXCTGTGATTGATGGTTTAGTTCCATTAACAGAGATGTCCAATTGTGTTAGTAAAGCTXTGCAGGGAATGACAAAG
GAGCGTGCATCGTACATTATGCAATTAGCCAAATTTGATGTCCCTCAATACATACAAATTAACTTACCAAAAAGGAGGAAGCAGCAGTTG
CTTAGTCAGCCAGCTTTCAAATTTGAATCCACAAACTTAAAAATAGAGTTCAAATCTGTCTGTGAAGCTGTCGTCAACATTTCTCTTTGT
TTCGAAAGACCTGCGCAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan