ESTScan Details for Unigene SGN-U268151

Score 
259
Direction 
Forward
Predicted Peptide Sequence 
SKAXQGMTKERASYIMQLAKFDVPQYIQINLPKRRKQQLLSQPAFKFESTNLKIGEPRKSKNLLGEPRKAKMLDARRKTTFILNGNFASY
QDNCKHLRHQWIYERNLITLHAAPFKDTNFYSFEKYREHPLKFTGNDFKASIDFGK
Predicted Coding Sequence 
AGTAAAGCTXTGCAGGGAATGACAAAGGAGCGTGCATCGTACATTATGCAATTAGCCAAATTTGATGTCCCTCAATACATACAAATTAAC
TTACCAAAAAGGAGGAAGCAGCAGTTGCTTAGTCAGCCAGCTTTCAAATTTGAATCCACGAACTTAAAAATAGGTGAACCAAGAAAATCA
AAAAACCTTTTAGGTGAACCAAGAAAGGCAAAAATGTTGGATGCAAGAAGAAAAACAACTTTTATTCTCAATGGAAATTTTGCATCTTAT
CAAGACAACTGCAAACATTTGAGGCATCAATGGATTTATGAAAGGAATCTTATTACTCTACATGCAGCTCCATTTAAGGATACCAACTTC
TATTCTTTTGAAAAATACAGAGAGCATCCACTCAAATTTACTGGTAATGATTTCAAGGCATCAATAGATTTTGGAAAATGA\
Edits in Original Sequence 
(5')AGTAAAGCTXTGCAGGGAATGACAAAGGAGCGTGCATCGTACATTATGCAATTAGCCAAATTTGATGTCCCTCAATACATACAAAT
TAACTTACCAAAAAGGAGGAAGCAGCAGTTGCTTAGTCAGCCAGCTTTCAAATTTGAATCCACGAACTTAAAAATAGGTGAACCAAGAAA
ATCAAAAAACCTTTTAGGTGAACCAAGAAAGGCAAAAATGTTGGATGCAtAGAAGAAAAACAACTTTTATTCTCAATGGAAATTTTGCAT
CTTATCAAGACAACTGCAAACATTTGAGGCATCAATGGATTTATGAAAcGGAATCTTATTACTCTACATGCAGCTCCATTTAAGGATACC
AACTTCTATTCTTTTGAAAAATACAGAGAGCATCCACTCAAATTTACTGGTAATGATTTCAAGGCATCAATAGATTTTGGAAAATGA\(3')
ATTTTGTCATATTCTATGATCAGCTCTATGTAAGGCTATCAACTTCTATTCTTGTGAGAAATGTTGAAAAGTATTTAGAAGATAATTG
TCTGCATTGTAAACTTGTTTGTGGAATGGGAGAAATTAGTTGTATTATTGCACTTTGAAGTTCATGCGTATAACTTATGCAATGATCTAT
TAACTTTGAAACAATATATCTCTTAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan