Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U268182

Score 
295
Direction 
Forward
Predicted Peptide Sequence 
EEGTTGTDQDPNLVGKIRPDSLKKFGETTEKCLADYGVERPSMNEXAVESGVCTSSPRACHLDYPEENGTIHVSNLSPLSNGFRHVDVSS
SAAQMEKSKLDDPVVVWGPRVDNYVNXDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFRTEIEILSFXQPS
AFGFIDGYCDETNEMILVYDYIENGNLRSHLYGPDLXHYELGAEAGDMHRGQPEVCITFI
Predicted Coding Sequence 
XXAGAAGAAGGGACAACTGGAACAGATCAAGATCCCAATCTTGTTGGCAAAATTAGACCAGATTCCCTCAAGAAGTTTGGAGAAACAACG
GAGAAATGCTTAGCCGATTATGGTGTAGAGAGGCCATCTATGAATGAGGXTGCTGTGGAATCTGGAGTATGCACTTCATCTCCAAGAGCC
TGTCATTTAGATTATCCAGAAGAAAATGGTACCATCCATGTTAGCAACCTCTCTCCATTAAGCAATGGTTTCAGGCATGTTGATGTCAGT
TCTTCTGCTGCTCAAATGGAGAAATCAAAGTTAGATGATCCAGTAGTAGTCTGGGGTCCGAGGGTGGATAACTATGTGAATGAXGATTTG
CAGGAAGCAACTAACAACTTCGATGAGAAGTTTCACATTGGATTGGGTGGCTTTGGGAAAGTTTACAGGGGTGTTTTGCGTGATGGAACA
AAGGTGGCCCTGAAGAGGTGTAAGCGTGAGTCCTCACAAGGTATTGAAGAGTTCCGAACAGAAATTGAGATTCTCTCTTTTXTGCAGCCA
TCCGCATTTGGTTTCATTGATGGATACTGTGATGAAACAAATGAGATGATTCTAGTTTATGACTACATTGAGAATGGGAACCTCAGGAGC
CATTTGTATGGCCCAGATCTACXCCACTATGAGCTGGGAGCAGAGGCTGGAGATATGCATCGGGGGCAGCCAGAAGTCTGCATTACCTTC
ATA\
Edits in Original Sequence 
(5')XXAGAAGAAGGGACAACTGGAACAGATCAtAGATCCCAATCTTGTTGGCAAAATTAGACCAGATTCCCTCAAGAAGTTTGGAGAAA
CAACGGAGAAATGCTTAGCCGATTATGGTGTAGAGAGGCCATCTATGAATGAGGXTGCTGTGGAATCTGGAGTATGCACTTCATCTCCAA
GAGCCTGTCATTTaAGATTATCCAGAAGAAAATGGTACCATCCATGTTAGCAACCTCTCTCCATTAAGtCAATGGTTTCAGGCATGTTGA
TGTCAGTTCTTCTGCTGCTCAAATGGAGAAATCAAAGTTAGATGATCgCAGTAGTAGTCTGGGGTCCGAGGGTGGATAACTATGTGAATG
AXGATTTGCAGGAAGCAACTAACAACTTCGATGAGAAGTTTCACATTGGATTGGGTGGCTTTGGGAAAGTTTACAGGGGTGTTTTGCGTG
ATGGAACAAAGGTGGCCCTGAAGAGGTGTAAGCGTGAGTCCTCACAAGGTATTGAAGAGTTCCGAACAGAAATTGAGATTCTCTCTTTTX
TGCAGCCATCCGCATTTGGTTTCATTGATaGGATACTGTGATGAAACAAATGAGATGATTCTAGTTTATGACTACATTGAGAATGGGAAC
CTCAGGAGCCATTTGTATGGCCCAGATCTACXCCACTATGAGCTGGGAGCAGAGGCTGGAGATATGCATCGGGGGCAGCCAGAAGTCTGC
ATTACCTTCATA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan