Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U268253

Score 
689
Direction 
Forward
Predicted Peptide Sequence 
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIF
VVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
A
Predicted Coding Sequence 
ATGGGGCTCACATTCACCAAGCTCTTCAGTCGGCTTTTCGCCAAGAAGGAAATGCGCATTCTAATGGTTGGTCTTGATGCAGCTGGTAAG
ACCACCATATTGTACAAGTTGAAGCTGGGAGAGATCGTGACTACTATTCCTACCATTGGTTTCAATGTGGAGACTGTTGAGTACAAGAAC
ATCAGCTTCACTGTTTGGGATGTCGGGGGTCAGGACAAGATCCGTCCATTGTGGAGGCACTACTTCCAGAACACTCAGGGTCTCATTTTT
GTGGTTGATAGCAATGATAGAGACCGTGTTGTAGAAGCAAGAGATGAATTGCATAGGATGTTGAACGAGGATGAACTTCGGGATGCTGTG
CTTCTAGTTTTTGCTAACAAGCAAGATCTTCCTAATGCAATGAATGCTGCCGAAATAACTGATAAGCTTGGACTGCACTCCCTCAGGCAG
CGTCACTGGTACATCCAGAGCACTTGTGCAACTTCTGGAGAGGGGCTTTACGAGGGACTTGATTGGCTTTCTAACAACATTGCTAACAAG
GCTTAA\
Edits in Original Sequence 
CTCAGGTTTCTCTCTCAATAGATCCCTCCTTCAAAAAGCTCTTTTCAGGGATCATCATCAAGGAAGCGTA(5')ATGGGGCTCACATTCA
CCAAGCTCTTCAGTCGGCTTTTCGCCAAGAAGGAAATGCGCATTCTAATGGTTGGTCTTGATGCAGCTGGTAAGACCACCATATTGTACA
AGTTGAAGCTGGGAGAGATCGTGACTACTATTCCTACCATTGGTTTCAATGTGGAGACTGTTGAGTACAAGAACATCAGCTTCACTGTTT
GGGATGTCGGGGGTCAGGACAAGATCCGTCCATTGTGGAGGCACTACTTCCAGAACACTCAGGGTCTCATTTTTGTGGTTGATAGCAATG
ATAGAGACCGTGTTGTAGAAGCAAGAGATGAATTGCATAGGATGTTGAACGAGGATGAACTTCGGGATGCTGTGCTTCTAGTTTTTGCTA
ACAAGCAAGATCTTCCTAATGCAATGAATGCTGCCGAAATAACTGATAAGCTTGGACTGCACTCCCTCAGGCAGCGTCACTGGTACATCC
AGAGCACTTGTGCAACTTCTGGAGAGGGGCTTTACGAGGGACTTGATTGGCTTTCTAACAACATTGCTAACAAGGCTTAA\(3')AGTGA
TGCAGATTTGTTATTGTGGGTTGATCTGGATGCAGGCGGAGTTTTATCTAGTTGTTTTTTCTTCTCATGTCAGTGTGGTTATGAATATCA
TGTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan