ESTScan Details for Unigene SGN-U268288

Score 
80
Direction 
Forward
Predicted Peptide Sequence 
TDDPSIPSLRTSCKLVEVSTWKRFLMDTFA
Predicted Coding Sequence 
XXAACAGATGACCCCTCTATCCCGAGTTTGAGGACAAGCTGTAAGCTTGTGGAAGTTTCAACTTGGAAGAGGTTTTTGATGGACACTTTT
GCTTAA\
Edits in Original Sequence 
(5')XXAACAGATGACCCCTCTATCCCGAGTTTGAGGACAAGCTGTAAGCTTGTGGAAGTTTCAACTTGGAAGAGGTTTTTGATGGACAC
TTTTGCTTAA\(3')TCGGATCTGCATTAGTTTTGTTTTACATTTTTCTGTGTTTTGGCAGTATGTTTTACCATTTTCTATGTAGGAGTT
TGAACCGAAAGTGAGTTTGTTACTTCATTTATGTCATTTACAGAGACAAATCTTGCCCTTGGTGTTTTCAAAAGTGGTTTTTTAGTTCTT
TTAACAATTCCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan