ESTScan Details for Unigene SGN-U268326

Score 
1927
Direction 
Forward
Predicted Peptide Sequence 
MSEGEKVLPTASKDEKSGAAESKKSSESSTMEAPLGEGRTASTAAAGAGVQNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNQMAEQLQK
TFQGAAVEESVPNFDSQQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSGMLESLSNPAQKEQLEERMARIKEDPSLKPILEEIESGGP
AAMMRYWNDQDVLKKIGEAMGFAAGGEGGATSSEIPGPDETEEANEDESVVHQCASVGDAEGLKAALAAGADKDEEDSEGRTALHFACGY
GEVKCAQLLVEAGAKVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQQDVLKLLEKDAFXVNWQDVWSC
TIETLDVTECDSRHLYFEDLRDLIHT
Predicted Coding Sequence 
ATGTCTGAGGGAGAGAAGGTTTTGCCGACTGCATCCAAAGATGAGAAGTCTGGGGCAGCTGAGAGTAAAAAATCTTCTGAGTCTTCCACC
ATGGAAGCACCATTAGGAGAGGGGAGAACAGCCTCTACTGCTGCAGCTGGAGCTGGGGTCCAAAATCCCTTTGATTTCTCAGCCATGTCT
GGACTACTCAATGACCCAAGTATCAAAGAACTAGCAGAGCAGATTGCAAAAGACCCTGCATTTAACCAGATGGCAGAGCAGCTTCAGAAG
ACCTTTCAAGGTGCGGCAGTGGAAGAAAGTGTCCCCAACTTTGATAGCCAACAATACTACTCTACAATGCAACAGGTTATGCAAAATCCT
CAGTTTATGACCATGGCTGAGCGGCTTGGTAATGCATTGATGCAGGATCCATCCATGTCTGGCATGCTTGAGAGTTTGTCAAACCCTGCT
CAGAAGGAGCAACTTGAAGAACGGATGGCGCGCATTAAAGAAGACCCATCACTCAAACCAATCTTGGAAGAGATAGAGAGCGGAGGACCA
GCTGCAATGATGAGGTATTGGAACGATCAAGATGTTCTGAAGAAGATTGGTGAAGCAATGGGTTTTGCTGCTGGAGGAGAGGGTGGTGCT
ACCTCTTCTGAAATACCTGGGCCAGATGAAACAGAAGAGGCAAATGAAGATGAATCTGTTGTTCATCAGTGTGCTAGTGTTGGTGATGCA
GAGGGCTTGAAGGCTGCACTAGCTGCTGGTGCTGACAAAGATGAAGAAGACTCGGAAGGAAGGACAGCATTGCATTTTGCCTGTGGATAT
GGCGAGGTGAAGTGTGCTCAGCTCCTTGTTGAAGCTGGGGCAAAGGTTGATGCATTGGACAAGAACAAGAATACTGCTCTTCACTATGCT
GCTGGATATGGTAGGAAGGAGTGTGTAGCACTTCTGCTGGAGAACGGAGCTGCTGTAACTCTTCAAAACTTGGACGGAAAGACGCCAATT
GATGTTGCCAAACTCAACAACCAGCAGGATGTCCTAAAGCTGCTTGAGAAGGATGCATTTXCTGTGAACTGGCAAGATGTTTGGTCATGT
ACAATTGAAACTTTGGATGTCACAGAGTGTGATTCAAGACATCTGTACTTTGAGGATCTTAGGGATCTTATCCATACTTGA\
Edits in Original Sequence 
TGTGTAACTCACAAAAACCCTTTTGATTTCGTCTAACCCCAAATCTCCCATTTACTCAAGACTCTCACTTTTTTGGGTTACTTCTCTATC
TCTTTGTAGCC
(5')ATGTCTGAGGGAGAGAAGGTTTTGCCGACTGCATCCAAAGATGAGAAGTCTGGGGCAGCTGAGAGTAAAAAATCT
TCTGAGTCTTCCACCATGGAAGCACCATTAGGAGAGGGGAGAACAGCCTCTACTGCTGCAGCTGGAGCTGGGGTCCAAAATCCCTTTGAT
TTCTCAGCCATGTCTGGACTACTCAATGACCCAAGTATCAAAGAACTAGCAGAGCAGATTGCAAAAGACCCTGCATTTAACCAGATGGCA
GAGCAGCTTCAGAAGACCTTTCAAGGTGCGGCAGTGGAAGAAAGTGTCCCCAACTTTGATAGCCAACAATACTACTCTACAATGCAACAG
GTTATGCAAAATCCTCAGTTTATGACCATGGCTGAGCGGCTTGGTAATGCATTGATGCAGGATCCATCCATGTCTGGCATGCTTGAGAGT
TTGTCAAACCCTGCTCAGAAGGAGCAACTTGAAGAACGGATGGCGCGCATTAAAGAAGACCCATCACTCAAACCAATCTTGGAAGAGATA
GAGAGCGGAGGACCAGCTGCAATGATGAGGTATTGGAACGATCAAGATGTTCTGAAGAAGATTGGTGAAGCAATGGGTTTTGCTGCTGGA
GGAGAGGGTGGTGCTACCTCTTCTGAAATACCTGGGCCAGATGAAACAGAAGAGGCAAATGAAGATGAATCTGTTGTTCATCAGTGTGCT
AGTGTTGGTGATGCAGAGGGCTTGAAGGCTGCACTAGCTGCTGGTGCTGACAAAGATGAAGAAGACTCGGAAGGAAGGACAGCATTGCAT
TTTGCCTGTGGATATGGCGAGGTGAAGTGTGCTCAGCTCCTTGTTGAAGCTGGGGCAAAGGTTGATGCATTGGACAAGAACAAGAATACT
GCTCTTCACTATGCTGCTGGATATGGTAGGAAGGAGTGTGTAGCACTTCTGCTGGAGAACGGAGCTGCTGTAACTCTTCAAAACTTGGAC
GGAAAGACGCCAATTGATGTTGCCAAACTCAACAACCAGCAGGATGTCCTAAAGCTGCTTGAGAAGGATGCATTTXCTGTGAACTGGCAt
AGATGTTTGGTCATGTACAATTGAAACTTTGGATGTCACAGAGTGTGATTCAAGACATCTGTACTTTGAGGATCTTAGGGATCTTATCCA
TACTTGA\(3')TGTGTTATCTTTGCCAGTGTATAATTTTATTGTTTTTCTAAGATTGTGCCTGTTCGAAGAATTTCCTCTGGATGTTTT
GTATTTGTAAACATCTTTGCTACCATGTTAAATTAACCTTCCAATTTTTTTTCCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan