ESTScan Details for Unigene SGN-U268366

Score 
850
Direction 
Forward
Predicted Peptide Sequence 
MAGLAPEGSQFDAREFDVDMLRRQSLRPDHIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMNKPVRIL
VKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRV
LITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPANVADLL
Predicted Coding Sequence 
ATGGCTGGCTTGGCACCGGAAGGTTCTCAATTTGATGCTCGTGAATTTGATGTTGACATGTTGCGCAGGCAGTCTCTTCGCCCCGACCAC
ATCAAGATGTTTGTTCTGGATGAAGCTGATGAAATGCTCTCAAGAGGTTTCAAGGATCAGATTTATGATATTTTCCAATTGCTGCCACCA
AAGATTCAAGTTGGTGTTTTCTCTGCCACAATGCCACCAGAGGCCCTTGAAATTACTAGGAAGTTCATGAACAAGCCTGTGAGGATCCTT
GTGAAGCGTGATGAGCTCACTCTTGAAGGTATCAAGCAATTTTATGTCAATGTTGACAAGGAAGAGTGGAAGCTTGAAACTCTTTGCGAT
CTTTACGAGACCTTAGCCATCACCCAGAGTGTGATCTTTGTGAACACCAGGCGTAAGGTTGATTGGCTCACTGATAAGATGCGCAGCCGT
GATCACACAGTATCTGCCACTCATGGAGACATGGACCAGAACACCAGAGATATCATTATGCGAGAGTTCCGATCTGGGTCATCTCGTGTG
CTTATCACTACCGATCTTCTGGCACGTGGTATTGATGTGCAGCAAGTATCCCTTGTGATTAACTATGACCTTCCTACTCAGCCAGAAAAC
TACTTGCATCGTATTGGTCGTAGTGGACGATTTGGAAGGAAGGGTGTAGCTATCAATTTTGTCACAAAGGATGATGAAAGGATGCTTTTT
GACATTCAGAAGTTTTACAATGTTGTAGTGGAGGAGCTACCAGCCAATGTGGCCGATCTTCTTTGA\
Edits in Original Sequence 
ACAGTCTTTACAAACCCTAACCCCCAATCGCTTTTACCCACTTCTCCTCCTACTCTTTACTCTTTATTCCTCAGATCTTTAACTCATCTT
TATCAGTC
(5')ATGGCTGGCTTGGCACCGGAAGGTTCTCAATTTGATGCTCGTGAATTTGATGTTGACATGTTGCGCAGGCAGTCTCTT
CGCCCCGACCACATCAAGATGTTTGTTCTGGATGAAGCTGATGAAATGCTCTCAAGAGGTTTCAAGGATCAGATTTATGATATTTTCCAA
TTGCTGCCACCAAAGATTCAAGTTGGTGTTTTCTCTGCCACAATGCCACCAGAGGCCCTTGAAATTACTAGGAAGTTCATGAACAAGCCT
GTGAGGATCCTTGTGAAGCGTGATGAGCTCACTCTTGAAGGTATCAAGCAATTTTATGTCAATGTTGACAAGGAAGAGTGGAAGCTTGAA
ACTCTTTGCGATCTTTACGAGACCTTAGCCATCACCCAGAGTGTGATCTTTGTGAACACCAGGCGTAAGGTTGATTGGCTCACTGATAAG
ATGCGCAGCCGTGATCACACAGTATCTGCCACTCATGGAGACATGGACCAGAACACCAGAGATATCATTATGCGAGAGTTCCGATCTGGG
TCATCTCGTGTGCTTATCACTACCGATCTTCTGGCACGTGGTATTGATGTGCAGCAAGTATCCCTTGTGATTAACTATGACCTTCCTACT
CAGCCAGAAAACTACTTGCATCGTATTGGTCGTAGTGGACGATTTGGAAGGAAGGGTGTAGCTATCAATTTTGTCACAAAGGATGATGAA
AGGATGCTTTTTGACATTCAGAAGTTTTACAATGTTGTAGTGGAGGAGCTACCAGCCAATGTGGCCGATCTTCTTTGA\(3')GGTGGTG
GTTTTGGTTGTCTGAGCTGAATTCTTCCTTATATTAAGTAATTTAATATTTTATTCTTAGGTTAGTTAGAACCGCACTGGACTAAAAGTT
GGAAACTGCAGTTTCTGTGATTCGTCGTACTTTTCCAATTTTGTTGGTTTTGTCTTTTTGTATTGCAAGTCCACAACAACTTCAGGTTTT
GGATGTCTTTGAATTTTTAAGTATATTTGATTTAAACTTTTGGCCTAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan