ESTScan Details for Unigene SGN-U268401

Score 
493
Direction 
Reverse
Predicted Peptide Sequence 
MESKFAHIIVFFLLATSFETLMARKESDESEVIKLVKESESESWCKGKQRWPELIGVPTKLAKEIIEKENPSINDVPIILNGTPVPADFR
CNRVRLFDNILGDVVQIPWVA
Predicted Coding Sequence 
ATGGAGTCAAAGTTTGCTCACATCATTGTTTTCTTTCTTCTTGCAACTTCCTTTGAAACTCTCATGGCACGAAAAGAAAGTGATGAGTCA
GAAGTCATAAAACTTGTAAAGGAATCGGAATCTGAATCTTGGTGCAAAGGAAAACAAAGGTGGCCAGAACTTATTGGTGTACCAACAAAG
CTTGCTAAGGAAATAATTGAGAAGGAAAATCCATCCATAAATGATGTTCCAATAATATTGAATGGCACTCCAGTCCCAGCTGATTTTAGA
TGTAATCGAGTTCGTCTTTTTGATAACATTTTGGGTGATGTTGTACAAATTCCTTGGGTGGCTTAA\
Edits in Original Sequence 
CTAAAAGAAA(5')ATGGAGTCAAAGTTTGCTCACATCATTGTTTTCTTTCTTCTTGCAACTTCCTTTGAAACTCTCATGGCACGAAAAG
AAAGTGATGAGTCAGAAGTCATAAAACTTGTAAAGGAATCGGAATCTGAATCTTGGTGCAAAGGAAAACAAAGGTGGCCAGAACTTATTG
GTGTACCAACAAAGCTTGCTAAGGAAATAATTGAGAAGGAAAATCCATCCATAAATGATGTTCCAATAATATTGAATGGCACTCCAGTCC
CAGCTGATTTTAGATGTAATCGAGTTCGTCTTTTTGATAACATTTTGGGTGATGTTGTACAAATTCCTTGGGTGGCTTAA\(3')TTAAT
GGATTATTATTGAAGTAATTAAGCAGCCACATGTCAAAAATAATTAGGGTTCATGTATGTTCATTATAATAATGTCTCCATGTACTCTTA
CTATATATAATGGAATAAATACGTGTGGCTTAATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan