ESTScan Details for Unigene SGN-U268407

Score 
1000
Direction 
Forward
Predicted Peptide Sequence 
MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGSQYGVPRRRLTGHGHFVEDVVLSSDGMFALSGSWDGELRL
WDLQAGTTARRFVGHTKDVLSVAFSVDNRQIVSASRDKTIKLWNTLGECKYTIQEQDSHSDWVSCVRFSPNNLQPTIVSGSWDRTVKIWN
LTNCKLRSTLAGHSGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLDAGSIIHTLCFSPNRYWLCAATESSIKIWDLESKSVVV
DLKVDLKQESEMFGTAATDSKTKVIYCTSLSWSADGSTLFSGYTDGLIEFGELGVIREEEDPGEPFGHTEXKVI
Predicted Coding Sequence 
ATGTCGCAAGAATCACTAGTCCTCCGCGGCACCATGAAAGCCCACACTGACTGGGTCACTGCTATTGCAACCCCAATTGACAACTCCGAC
ATGATTGTCACCTCCTCCAGGGATAAGTCCATCATCGTCTGGTCTTTGACTAAAGACGGTTCACAATACGGTGTCCCTCGCCGCCGCCTT
ACCGGACACGGCCATTTCGTTGAAGATGTCGTGTTGTCGTCTGACGGCATGTTTGCACTCTCCGGTTCATGGGACGGTGAGCTCCGTTTA
TGGGATCTTCAAGCTGGAACCACTGCTCGTCGTTTCGTTGGACACACTAAAGATGTTCTCTCCGTTGCTTTCTCTGTTGACAACCGTCAG
ATTGTCTCTGCTTCCCGTGACAAGACCATCAAGCTCTGGAACACACTCGGTGAGTGCAAGTACACAATTCAGGAACAGGATTCACACTCT
GATTGGGTTTCTTGTGTCCGTTTTAGCCCAAATAATCTTCAGCCCACTATTGTTTCTGGTTCATGGGATCGCACTGTGAAAATCTGGAAT
CTTACCAACTGTAAGCTCAGGTCCACTCTTGCGGGACACAGTGGGTATGTGAATACTGTGGCCGTGTCTCCAGATGGTTCGTTGTGTGCT
AGCGGAGGGAAAGATGGAGTCATATTGCTATGGGATTTGGCTGAAGGAAAGAAACTGTACTCTCTTGATGCTGGCTCCATTATCCACACC
CTCTGTTTTAGCCCGAATAGGTATTGGCTCTGTGCTGCTACTGAATCTAGTATCAAGATTTGGGATTTGGAGAGCAAAAGCGTCGTGGTT
GATCTTAAAGTTGATCTGAAACAAGAGAGTGAAATGTTCGGAACTGCTGCTACCGATTCCAAGACCAAGGTCATATACTGCACCAGTTTG
AGCTGGAGTGCTGATGGAAGCACACTTTTCAGTGGCTATACAGATGGTCTGATTGAGTTTGGGGAATTGGGCGTTATTAGGGAAGAAGAG
GATCCAGGGGAGCCATTTGGCCATACTGAAXTTAAAGTCATTTAA\
Edits in Original Sequence 
CTACTCTTTACAACTAAAAGAAAATGGTGTCAAAGTTTGCTCACATCATTGTTTTCTTTCTTCTTGCAACTTCCTTTGAAACTCTCTTGG
CACGAAAAGAAAGTGATGGACCAGAAGTCATAGAACTTCTAAAGGAATTTGAATGCAATGGAAAACAATTCTGGCCAGAACTTATTGGTG
TACCAACAAAGCTTGCTAAGGAAATAATTGAGAAGGAAAATTCACTCATAAATAATGTTCAGATATTATTGAATGGTTCTCCAGTCACAA
TGGATTATCGTTGTAATCGAGTTCGTCTTTTTGATAACATTTTGGGTTCTGTTGTACAAATTCCTAGGGTGGCTTAATTAATGGATTATT
ATTGAAGTAATTAAGCAGCCACATGTCAAAAATAATTAGGGTTCATGTATGTTCATTATAATGTCTTCATGTACTCTTACTATATATAAT
GAAATAAATAAGAGTGGCTTAATTAATTAAAAAAAAAATTCTCTGCCACCAAAGGTGATTTCACTGACGGCCGCCACCAATCTGACAAA
(5')ATGTCGCAAGAATCACTAGTCCTCCGCGGCACCATGAAAGCCCACACTGACTGGGTCACTGCTATTGCAACCCCAATTGACAACTCC
GACATGATTGTCACCTCCTCCAGGGATAAGTCCATCATCGTCTGGTCTTTGACTAAAGACGGTTCACAATACGGTGTCCCTCGCCGCCGC
CTTACCGGACACGGCCATTTCGTTGAAGATGTCGTGTTGTCGTCTGACGGCATGTTTGCACTCTCCGGTTCATGGGACGGTGAGCTCCGT
TTATGGGATCTTCAAGCTGGAACCACTGCTCGTCGTTTCGTTGGACACACTAAAGATGTTCTCTCCGTTGCTTTCTCTGTTGACAACCGT
CAGATTGTCTCTGCTTCCCGTGACAAGACCATCAAGCTCTGGAACACACTCGGTGAGTGCAAGTACACAATTCAGGAACAGGATTCACAC
TCTGATTGGGTTTCTTGTGTCCGTTTTAGCCCAAATAATCTTCAGCCCACTATTGTTTCTGGTTCATGGGATCGCACTGTGAAAATCTGG
AATCTTACCAACTGTAAGCTCAGGTCCACTCTTGCGGGACACAGTGGGTATGTGAATACTGTGGCCGTGTCTCCAGATGGTTCGTTGTGT
GCTAGCGGAGGGAAAGATGGAGTCATATTGCTATGGGATTTGGCTGAAGGAAAGAAACTGTACTCTCTTGATGCTGGCTCCATTATCCAC
ACCCTCTGTTTTAGCCCGAATAGGTATTGGCTCTGTGCTGCTACTGAATCTAGTATCAAGATTTGGGATTTGGAGAGCAAAAGCGTCGTG
GTTGATCTTAAAGTTGATCTGAAACAAGAGAGTGAAATGTTCGGAACTGCTGCTACCGATTCCAAGACCAAGGTCATATACTGCACCAGT
TTGAGCTGGAGTGCTGATGGAAGCACACTTTTCAGTGGCTATACAGATGGTCTGATTaGAGTTTGGGGAATTGGGCGTTATTAGGGAAGA
AGAGGATCCAGGGGAGCCATTTGGCCATACTGAAXTTAAAGTCATTTAA\(3')ATTTCGAAGATTCTCCCTGTGTTTCATTGTTATGAG
GCCTCAACTGTTTCAATTTTGGATTCTTATTTAGTGCGTATTTGTTACATTGGATATCTGTCTTATTATAAATCTTAAGTTGTTTTGCTT
AAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan