ESTScan Details for Unigene SGN-U268495

Score 
712
Direction 
Forward
Predicted Peptide Sequence 
MTKLXEYHIQDKQKIGEENKEVQGEELPVRDDAVVSEPNNEGKERNVVVEQRLVEESFEMQGNEPVAAEPETADNAAHVIEEPVDGTKAT
AAPASEAVTTETDLSREKELGVADDHNTHRSCDAVEGNSVDTSHSFGSSTPIEVQVMDANKLKEWMKVDMSPSSPTAAKNPVIVMXLSX
Predicted Coding Sequence 
ATGACGAAGCTCGAXGAGTACCATATTCAAGATAAGCAGAAAATTGGGGAGGAAAATAAGGAGGTGCAAGGTGAGGAATTGCCAGTTCGT
GATGATGCTGTCGTCTCTGAACCTAATAATGAAGGAAAAGAGCGTAATGTGGTGGTTGAGCAGCGGCTTGTGGAGGAGAGCTTTGAGATG
CAAGGGAACGAACCAGTGGCTGCTGAACCAGAAACTGCCGATAATGCTGCACATGTGATCGAGGAACCAGTGGATGGAACTAAAGCTACG
GCTGCTCCAGCATCAGAAGCTGTAACTACCGAGACAGACCTGTCAAGGGAGAAAGAGCTTGGTGTAGCAGATGACCACAACACACATCGA
TCTTGTGATGCCGTGGAAGGTAATTCTGTTGATACTTCCCATTCTTTTGGTTCTTCTACGCCTATTGAAGTACAAGTTATGGATGCAAAC
AAGCTTAAAGAATGGATGAAAGTGGACATGTCCCCATCGTCACCTACTGCAGCCAAGAATCCTGTGATAGTGATGNCGCTGTCTGXX\
Edits in Original Sequence 
GATTTTCAGAGCAGTTTTACAAAGAGAGAAGCGAAGTTTGAGTACTGAAGAAGCTGGGTTGGTGGAGTGATTTGTGCTGGAAATTGAGTT
ATTTGGATTTTGTGGAACCGATTGGACGGAGCTTTTATTCTTCCTTAATTGTAATTCTATACACACATAAAAGGGAAGCTTAATTTGGAC
CTGCATTTGAACCAAGCTATGTATCCCATGAATCCTTACCA
(5')ATGACGAAGCTCGAXGAGTACCATATTCAAGATAAGCAGAAAATT
GGGGAGGAAAATAAGGAGGTGCAAGGTGAGGAATTGCCAGTTCGTGATGATGCTGTCGTCTCTGAACCTAATAATGAAGGAAAAGAGCGT
AATGTGGTGGTTGAGCAGCGGCTTGTGGAGGAGAGCTTTGAGATGCAAGGGAACGAACCAGTGGCTGCTGAACCAGAAACTGCCGATAAT
GCTGCACATGTGATCGAGGAACCAGTGGATGGAACTAAAGCTACGGCTGCTCCAGCATCAGAAGCTGTAACTACCGAGACAGACCTGTCA
AGGGAGAAAGAGCTTGGTGTAGCAGATGACCACAACACACATCGATCTTGTGATGCCGTGGAAGGTAATTCTGTTGATACTTCCCATTCT
TTTGGTTCTTCTACGCCTATTGAAGTACAAGTTATGGATGCAAACAAGCTTAAAGAATGGATGAAAGTGGACATGTCCCCATCGTCACCT
ACTGcCAGCCAAGAATCCTGTGATAGTGATGNCGCTGTCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan