ESTScan Details for Unigene SGN-U268496

Score 
3790
Direction 
Forward
Predicted Peptide Sequence 
MYPMNPYQRNQVPYNPHYYPHFESNPHHHMNIDPTDLHYLMNLGLVVVAAMGILIHLSVTVAVSITILRASXAFSPPYPYLPPPTYPVMY
PTHYVPPPHFSMEQPRYEYEKNMGRDHHCCGCSNHQCGSKKGGGSSVKIEEHGQDKKNESNESLVPFGFKNCPYPVVSLPPDDMKNREHM
KPNGSNCKEEEENPQVVKPFGDFRPFQQPNVWNLWPSHYGNSSESPKQTGDLPGKQQDDDSIRKQFPFPIIWMPYKPEEDGERVGKETES
GLIAEKEPTSPSKLTKPMLHDSEDKRSSSKENEVISGSEIRGKGLNKGTVVKIIPVKQVEQNEIFDRKKEEASERHESDAKQKKIAQEGG
KKQSPSPTKSSKLPPVCLRVDPLPRKKSSNGNSRSPSPPCGKGKLVESRSESSKPPIQSNEKENVQLDKSSTTSMPKKSTEVEPSKGKTK
VVEVAQGTSKEDKLQDQCTVFSDLKRQARSQTGEGDTSKAANKPKDEPDAVAAKAQSSNEGHHRGEAREAANVDVGAGNEMKRVKRSQLS
DDKAAXHDSVGIPRFQRAEMGASEEIKADAKIEEQMAEIKKRIQDLESSADNGVDNKQRTIITEIXNESSAETRAIQGLHPAVREYRKSV
AKELVSLQEKLDLLNCKKQPAESEETFTAKSSEDTCTAVEDNPSLQGQEVQKLERDDDFTKGDEGIKFDAEGLCEEQPLCATEMLPDSHD
VGNAVLEGKEENKDVEEVMEGVSGSSAVKTGDGASVKPFESEEKTDKLLDENTAVVEKLEERGDGVDELEELPRGVLDEETSIKGSAEIR
KDTVDLTALTLDEKVSDTASLEHHHLEALGETPFILGTENMHSSNGVEENAEILERDAAVPIDIPKREKEDAKPLSEDANISDVDDKVGM
EKNEKELDQGGSASDGFSIPSQEDAITTEQPTDTTNAEESETVEVLQEKMQNAVDKDIEILDSGKPVEKSVEPQLSTGTNDEAREYHIQD
KQKIGEENKEVQGEELPVRDDAVVSEPNNEGKERNVVVEQRLVEESFEMQGNEPVAAEPETADNAAHVIEEPVDGSKATAAPASEAVTTE
TDLSREKELGVADDHNTHRSCDAVEGNSVDTSHSFGSSTPIEVQVMDANKLKEWMKVDMSPSSPTASQESCDSDALSESDKKLIEENEKL
REMMEKLIKSGNEQLTAISSLYGRVKDLEKRLSKKKKLKLKRNRVPAAGSACVKPLNDSLRNRSVGLAMKNKKLGDSFEWNSSLVHVXLF
VFHSMLCINKAFSAQLIFLLVLVLMQYDFKVACLALRRDNSDFKVTCLALRRDNIDFKVTCLVLRRDSSFSCFKFHV
Predicted Coding Sequence 
ATGTATCCCATGAATCCTTACCAACGGAACCAAGTACCTTACAATCCTCATTATTATCCCCACTTCGAATCGAATCCTCATCATCATATG
AACATTGATCCAACTGATCTACATTACCTTATGAATCTTGGCCTTGTGGTGGTAGCAGCTATGGGCATCCTTATCCACCTCAGTGTCACA
GTTGCTGTATCCATAACAATTCTCCGAGCCAGTGXTGCATTTAGCCCTCCGTATCCTTACCTTCCACCACCTACATATCCTGTGATGTAT
CCTACTCATTATGTTCCTCCTCCACATTTTAGTATGGAGCAGCCCCGATACGAGTATGAAAAGAATATGGGCAGAGATCATCACTGTTGT
GGTTGTTCAAATCATCAATGTGGTAGTAAGAAAGGAGGAGGGAGCAGTGTCAAAATAGAAGAACATGGCCAGGATAAGAAAAACGAAAGT
AACGAGTCATTGGTTCCTTTTGGGTTCAAGAATTGTCCTTATCCAGTTGTGAGCTTACCACCTGATGACATGAAGAATAGGGAGCACATG
AAGCCTAATGGATCCAATTGTAAAGAGGAGGAGGAGAATCCGCAAGTTGTGAAGCCGTTTGGCGATTTCAGGCCCTTCCAGCAACCAAAT
GTCTGGAATTTATGGCCTTCTCATTATGGGAACAGCTCAGAATCACCAAAGCAAACGGGAGATTTACCCGGAAAACAACAAGATGATGAT
TCGATCAGGAAGCAGTTTCCATTTCCAATAATCTGGATGCCTTATAAGCCCGAGGAAGACGGAGAGAGAGTTGGTAAGGAAACTGAGTCT
GGCCTCATTGCTGAGAAGGAGCCAACCTCCCCCTCAAAATTAACCAAACCAATGTTACATGATTCTGAAGACAAGAGAAGCAGTTCTAAA
GAAAATGAAGTGATTAGCGGAAGTGAAATCCGTGGAAAGGGACTGAATAAAGGGACTGTTGTGAAAATCATTCCTGTAAAGCAAGTGGAG
CAGAATGAGATCTTTGATAGAAAAAAAGAGGAGGCTTCCGAGAGGCATGAAAGTGATGCTAAACAGAAGAAAATTGCTCAAGAAGGTGGT
AAGAAACAGTCCCCTTCTCCTACAAAGTCATCGAAGTTGCCTCCTGTTTGTTTAAGGGTTGATCCCCTTCCTAGGAAGAAAAGCAGTAAT
GGCAATTCTAGGTCTCCTAGTCCTCCTTGTGGGAAAGGGAAATTAGTAGAATCGCGCAGTGAGAGCTCCAAACCTCCCATCCAATCAAAT
GAGAAGGAGAATGTTCAACTAGACAAATCATCAACAACAAGCATGCCAAAAAAAAGCACAGAAGTGGAGCCAAGTAAAGGCAAGACAAAA
GTTGTTGAGGTTGCCCAAGGGACATCTAAAGAAGATAAACTTCAGGATCAATGTACTGTTTTCTCTGATCTGAAACGCCAGGCAAGGAGC
CAAACTGGTGAAGGCGATACTAGTAAAGCGGCAAATAAGCCAAAAGATGAACCTGATGCAGTAGCTGCAAAAGCTCAGTCCAGCAATGAA
GGACATCACAGAGGTGAGGCCAGAGAAGCAGCCAATGTAGATGTGGGTGCAGGCAATGAGATGAAACGAGTAAAGAGGAGTCAACTGTCC
GATGATAAGGCAGCTXACCATGATTCAGTCGGTATACCGAGGTTTCAACGTGCGGAGATGGGAGCCTCTGAAGAAATTAAAGCAGATGCC
AAAATAGAGGAGCAGATGGCTGAGATCAAAAAACGTATTCAGGATTTGGAGAGCTCAGCTGACAATGGAGTCGACAACAAACAGAGAACT
ATTATCACAGAAATCATXAACGAGTCTTCTGCTGAAACTAGAGCTATTCAGGGGTTGCATCCAGCTGTTAGGGAATATAGAAAATCCGTA
GCGAAGGAGCTTGTTAGCCTGCAGGAGAAGCTGGATCTTCTAAACTGTAAAAAGCAACCAGCAGAAAGTGAAGAGACTTTTACTGCCAAA
TCTAGTGAGGATACATGCACGGCGGTGGAAGACAACCCTTCCTTGCAGGGCCAAGAGGTGCAAAAGTTGGAAAGGGATGATGATTTTACT
AAGGGGGATGAAGGAATAAAGTTTGATGCAGAAGGACTTTGTGAAGAGCAGCCTCTTTGTGCAACAGAGATGCTACCCGACTCCCATGAT
GTAGGCAATGCAGTACTAGAGGGAAAAGAAGAAAACAAGGACGTTGAGGAGGTAATGGAAGGCGTTTCGGGCAGCAGTGCAGTGAAGACA
GGAGATGGAGCATCAGTAAAACCTTTTGAATCTGAAGAAAAAACAGATAAGTTGCTTGATGAGAACACAGCAGTAGTTGAGAAATTAGAA
GAGCGTGGAGATGGTGTGGATGAGTTGGAAGAACTTCCTCGAGGAGTCCTTGATGAAGAGACCAGCATTAAAGGTTCTGCTGAAATCAGA
AAAGACACAGTAGACCTTACTGCACTTACCCTTGACGAAAAAGTCTCTGATACAGCGAGTCTAGAGCACCACCACTTGGAAGCATTGGGT
GAAACACCATTTATTTTGGGGACGGAGAATATGCACAGCAGCAATGGAGTAGAGGAAAATGCAGAAATTCTGGAAAGAGATGCAGCAGTA
CCAATTGACATTCCCAAACGAGAGAAAGAAGATGCAAAACCATTAAGTGAAGATGCAAACATATCCGATGTGGATGACAAGGTTGGTATG
GAGAAGAATGAAAAAGAGCTTGATCAAGGCGGTAGTGCATCAGATGGTTTTTCAATACCATCACAGGAAGACGCAATCACCACAGAGCAG
CCTACAGATACTACCAACGCAGAGGAATCAGAAACAGTTGAGGTTCTGCAGGAGAAAATGCAAAATGCAGTTGACAAAGATATTGAAATC
CTTGATTCAGGAAAACCAGTAGAAAAATCGGTGGAACCTCAACTATCCACTGGTACCAATGACGAAGCTCGAGAGTACCATATTCAAGAT
AAGCAGAAAATTGGGGAGGAAAATAAGGAGGTGCAAGGTGAGGAATTGCCAGTTCGTGATGATGCTGTCGTCTCTGAACCTAATAATGAA
GGAAAAGAGCGTAATGTGGTGGTTGAGCAGCGGCTTGTGGAGGAGAGCTTTGAGATGCAAGGGAACGAACCAGTGGCTGCTGAACCAGAA
ACTGCCGATAATGCTGCACATGTGATCGAGGAACCAGTGGATGGAAGTAAAGCTACGGCTGCTCCAGCATCAGAAGCTGTAACTACCGAG
ACAGACCTGTCAAGGGAGAAAGAGCTTGGTGTAGCAGATGACCACAACACACATCGATCTTGTGATGCCGTGGAAGGTAATTCTGTTGAT
ACTTCCCATTCTTTTGGTTCTTCTACGCCTATTGAAGTACAAGTTATGGATGCAAACAAGCTTAAAGAATGGATGAAAGTGGACATGTCC
CCATCGTCACCTACTGCCAGCCAAGAATCCTGTGATAGTGATGCGCTGTCTGAGAGCGATAAAAAACTTATAGAGGAGAATGAAAAATTA
AGGGAGATGATGGAGAAGTTAATTAAATCAGGGAATGAACAACTGACTGCCATATCCAGTCTTTATGGAAGAGTTAAGGACCTGGAGAAG
AGATTGTCTAAGAAGAAGAAGCTAAAATTGAAACGAAATAGGGTACCAGCAGCTGGATCAGCCTGTGTAAAGCCATTGAATGACTCACTT
AGAAACAGGTCTGTGGGGTTGGCAATGAAGAACAAAAAGCTTGGTGATTCCTTTGAATGGAATAGTAGTTTGGTTCATGTAGXTCTGTTT
GTGTTCCATAGTATGCTATGTATAAATAAGGCTTTTTCTGCTCAATTAATATTCCTTTTGGTTTTGGTTCTTATGCAATACGACTTTAAA
GTTGCTTGTTTGGCACTGAGGCGTGACAATAGCGACTTCAAAGTTACTTGTTTGGCACTGAGGCGTGACAATATCGACTTCAAAGTTACT
TGTTTGGTATTGAGGCGTGACAGTAGTTTTTCATGTTTTAAATTCCACGTTTAA\
Edits in Original Sequence 
AAAAAAAAAGATTTTCAGAGCAGTTTTACAAAGAGAGAAGCGAAGTTTGAGTACTGAAGAAGCTGGGTTGGTGGAGTGATTTGTGCTGGA
AATTGAGTTATTTGGATTTTGTGGAACCGATTGGACGGAGCTTTTATTCTTCCTTAATTGTAATTCTATACACACATAAAAGGGAAGCTT
AATTTGGACCTGCATTTGAACCAAGCT
(5')ATGTATCCCATGAATCCTTACCAACGGAACCAAGTACCTTACAATCCTCATTATTATCC
CCACTTCGAATCGAATCCTCATCATCATATGAACATTGATCCAACTaGATCTACATTACCTTATGAATCTTGGCCTTGTGGTGGTAGCAG
CTATGGGCATCCTTATCCACCTCAGTGTCACAGTTGCTGTATCCATAACAATTCTCCGAGCCAGTGXTGCATTTAGCCCTCCGTATCCTT
ACCTTCCACCACCTACATATCCTGTGATGTATCCTACTCATTATGTTCCTCCTCCACATTTTAGTATGGAGCAGCCCCGATACGAGTATG
AAAAGAATATGGGCAGAGATCATCACTGTTGTGGTTGTTCAAATCATCAATGTGGTAGTAAGAAAGGAGGAGGGAGCAGTGTCAAAATAG
AAGAACATGGCCAGGATAAGAAAAACGAAAGTAACGAGTCATTGGTTCCTTTTGGGTTCAAGAATTGTCCTTATCCAGTTGTGAGCTTAC
CACCTGATGACATGAAGAATAGGGAGCACATGAAGCCTAATGGATCCAATTGTAAAGAGGAGGAGGAGAATCCGCAAGTTGTGAAGCCGT
TTGGCGATTTCAGGCCCTTCCAGCAACCAAATGTCTGGAATTTATGGCCTTCTCATTATGGGAACAGCTCAGAATCACCAAAGCAAACGG
GAGATTTACCCGGAAAACAACAAGATGATGATTCGATCAGGAAGCAGTTTCCATTTCCAATAATCTGGATGCCTTATAAGCCCGAGGAAG
ACGGAGAGAGAGTTGGTAAGGAAACTGAGTCTGGCCTCATTGCTGAGAAGGAGCCAACCTCCCCCTCAAAATTAACCAAACCAATGTTAC
ATGATTCTGAAGACAAGAGAAGCAGTTCTAAAGAAAATGAAGTGATTAGCGGAAGTGAAATCCGTGGAAAGGGACTGAATAAAGGGACTG
TTGTGAAAATCATTCCTGTAAAGCAAGTGGAGCAGAATGAGATCTTTGATAGAAAAAAAGAGGAGGCTTCCGAGAGGCATGAAAGTGATG
CTAAACAGAAGAAAATTGCTCAAGAAGGTGGTAAGAAACAGTCCCCTTCTCCTACAAAGTCATCGAAGTTGCCTCCTGTTTGTTTAAGGG
TTGATCCCCTTCCTAGGAAGAAAAGCAGTAATGGCAATTCTAGGTCTCCTAGTCCTCCTTGTGGGAAAGGGAAATTAGTAGAATCGCGCA
GTGAGAGCTCCAAACCTCCCATCCAATCAAATGAGAAGGAGAATGTTCAACTAGACAAATCATCAACAACAAGCATGCCAAAAAAAAGCA
CAGAAGTGGAGCCAAGTAAAGGCAAGACAAAAGTTGTTGAGGTTGCCCAAGGGACATCTAAAGAAGATAAACTTCAGGATCAATGTACTG
TTTTCTCTGATCTGAAACGCCAGGCAAGGAGCCAAACTGGTGAAGGCGATACTAGTAAAGCGGCAAATAAGCCAAAAGATGAACCTGATG
CAGTAGCTGCAAAAGCTCAGTCCAGCAATGAAGGACATCACAGAGGTGAGGCCAGAGAAGCAGCCAATGTAGATGTGGGTGCAGGCAATG
AGATGAAACGAGTAAAGAGGAGTCAACTGTCCGATGATAAGGCAGCTXACCATGATTCAGTCGGTATACCGAGGTTTCAACGTGCGGAGA
TGGGAGCCTCTGAAGAAATTAAAGCAGATaGCCAAAATAGAGGAGCAGATGGCTGAGATCAAAAAACGTATTCAGGATTTGGAGAGCTCA
GCTGACAATGGAGTCGACAACAAACAGAGAACTATTATCACAGAAATCATXAACGAGTCTTCTGCTGAAACTAGAcGCTATTCAGGGGTT
GCATCCAGCTGTTAGGGAATATAGAAAATCCGTAGCGAAGGAGCTTGTTAGCCTGCAGGAGAAGCTGGATCTTCTAAACTGTAAAAAGCA
ACCAGCAGAAAGTGAAGAGACTTTTACTGCCAAATCTAGTGAGGATACATGCACGGCGGTGGAAGACAACCCTTCCTTGCAGGGCCAAGA
GGTGCAAAAGTTGGAAAGGGATGATGATTTTACTAAGGGGGATGAAGGAATAAAGTTTGATGCAGAAGGACTTTGTGAAGAGCAGCCTCT
TTGTGCAACAGAGATGCTACCCGACTCCCATGATGTAGGCAATGCAGTACTAGAGGGAAAAGAAGAAAACAAGGACGTTGAGGAGGTAAT
GGAAGGCGTTTCGGGCAGCAGTGCAGTGAAGACAGGAGATGGAGCATCAGTAAAACCTTTTGAATCTGAAGAAAAAACAGATAAGTTGCT
TGATGAGAACACAGCAGTAGTTGAGAAATTAGAAGAGCGTGGAGATGGTGTGGATGAGTTGGAAGAACTTCCTCGAGGAGTCCTTGATGA
AGAGACCAGCATTAAAGGTTCTGCTGAAATCAGAAAAGACACAGTAGACCTTACTGCACTTACCCTTGACGAAAAAGTCTCTGATACAGC
GAGTCTAGAGCACCACCACTTGGAAGCATTGGGTGAAACACCATTTATTTTGGGGACGGAGAATATGCACAGCAGCAATGGAGTAGAGGA
AAATGCAGAAATTCTGGAAAGAGATGCAGCAGTACCAATTGACATTCCCAAACGAGAGAAAGAAGATGCAAAACCATTAAGTGAAGATGC
AAACATATCCGATGTGGATGACAAGGTTGGTATGGAGAAGAATGAAAAAGAGCTTGATCAAGGCGGTAGTGCATCAGATGGTTTTTCAAT
ACCATCACAGGAAGACGCAATCACCACAGAGCAGCCTACAGATACTACCAACGCAGAGGAATCAGAAACAGTTGAGGTTCTGCAGGAGAA
AATGCAAAATGCAGTTGACAAAGATATTGAAATCCTTGATTCAGGAAAACCAGTAGAAAAATCGGTGGAACCTCAACTATCCACTGGTAC
CAATGACGAAGCTCGAGAGTACCATATTCAAGATAAGCAGAAAATTGGGGAGGAAAATAAGGAGGTGCAAGGTGAGGAATTGCCAGTTCG
TGATGATGCTGTCGTCTCTGAACCTAATAATGAAGGAAAAGAGCGTAATGTGGTGGTTGAGCAGCGGCTTGTGGAGGAGAGCTTTGAGAT
GCAAGGGAACGAACCAGTGGCTGCTGAACCAGAAACTGCCGATAATGCTGCACATGTGATCGAGGAACCAGTGGATGGAAGTAAAGCTAC
GGCTGCTCCAGCATCAGAAGCTGTAACTACCGAGACAGACCTGTCAAGGGAGAAAGAGCTTGGTGTAGCAGATGACCACAACACACATCG
ATCTTGTGATGCCGTGGAAGGTAATTCTGTTGATACTTCCCATTCTTTTGGTTCTTCTACGCCTATTGAAGTACAAGTTATGGATGCAAA
CAAGCTTAAAGAATGGATGAAAGTGGACATGTCCCCATCGTCACCTACTGCCAGCCAAGAATCCTGTGATAGTGATGCGCTGTCTGAGAG
CGATAAAAAACTTATAGAGGAGAATGAAAAATTAAGGGAGATGATGGAGAAGTTAATTAAATCAGGGAATGAACAACTGACTGCCATATC
CAGTCTTTATGGAAGAGTTAAGGACCTGGAGAAGAGATTGTCTAAGAAGAAGAAGCTAAAATTGAAACGAAATAGGGTACCAGCAGCTGG
ATCAGCCTGTGTAAAGCCATTGAATGACTCACTTAGAAACAGGTCTGTGGGGTTGGCAATGtAAGAACAAAAAGCTTGGTGATTCCTTTG
AATGGAATAGTAGTTTGGTTCATGTAGXTCTGTTTGTGTTCCATAGTATGCTATGTATAAATAAGGCTTTTTCTGCTCAATTAATATTCC
TTTTGGTTTTGGTTCTTATGCAATAgCGACTTTAAAGTTGCTTGTTTGGCACTGAGGCGTGACAATAGCGACTTCAAAGTTACTTGTTTG
GCACTGAGGCGTGACAATATCGACTTCAAAGTTACTTGTTTGGTATTGAGGCGTGACAGTAGTTTTTCATGTTTTAAATTCCACGTTTAA
\(3')ATGGTTAATAGATGATCACCCTTTTCAAACAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan