ESTScan Details for Unigene SGN-U268747

Score 
2316
Direction 
Forward
Predicted Peptide Sequence 
MDEDFGIPPVEGMNEDMDLPDDSSTLKVGEEKEIGNQGLKKKLVKEGEGWDTPAPGDEVEVHYTGTLLEEPSSIPVAIEGTPSXFTLGQG
QVIKGWDQGINTMKKGENAIFTIPPELAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILTEGEKWENPKDLDEVFVKYE
AQLENGTVVGKSDGVEFTVQDGHFCPALAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPPNATLQINLELVSWKTVSNVTDDK
KVLKKILKEGEGYERPNEGAVVKLKLVGKLLDGTVFTKKGHDGENEDNLFEFKTDEEQVIDGLDRAVLTMKKGEAALLTIAPEYAFGSSE
SKQDLAVVPPNSTVHYEVELVSFVKDKESWDMNTPEKIESAGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDTSFSEEEKKQSKALKI
TCNLNNAACKLKLKDYKQAEKLCTKVLELDSANVKALYRRAQAYMNMADLDLAEFDIKKALEIDPDNRDVKLEYKALKEKVKEINKKDAK
FYGNMFAKLTKQDAANSANSAPKEPEPMSIDARHNFNSDMTKKDQHHYLDCSNEMSYLPWSRYSWILGKSXLLNNLTVISDSALGTYING
SSCNRVSSGVFGVTSFS
Predicted Coding Sequence 
ATGGACGAGGATTTTGGTATTCCACCGGTAGAGGGAATGAACGAGGACATGGATCTGCCGGATGACAGTTCGACCCTGAAAGTAGGCGAG
GAGAAGGAAATTGGAAATCAGGGATTGAAGAAGAAGCTTGTTAAGGAAGGTGAAGGTTGGGATACTCCTGCGCCTGGTGATGAAGTCGAA
GTTCATTATACTGGAACTTTGCTTGAGGAACCAAGTTCGATTCCAGTCGCGATAGAGGGGACCCCTTCAAGXTTTACTCTCGGTCAAGGA
CAAGTTATTAAAGGATGGGATCAAGGTATAAATACAATGAAGAAAGGTGAAAATGCTATTTTCACCATTCCTCCAGAGCTTGCTTATGGA
GAGAGTGGTTCTCCTCCAACTATCCCTCCAAATGCCACTCTACAATTTGATGTTGAGTTGCTATCATGGGTGAGTGTAAAAGACATTTGC
AAGGATGGTGGAATTTTCAAAAAGATCCTCACAGAGGGGGAGAAATGGGAAAACCCGAAAGATCTTGACGAAGTATTTGTCAAGTACGAA
GCTCAGCTTGAAAATGGCACAGTGGTGGGAAAATCAGATGGAGTGGAGTTCACTGTTCAAGATGGTCATTTCTGTCCTGCTCTTGCTAAG
GCTGTGAAAACTATGAAGAAAGGTGAAAAGGTCCAATTGACAGTGAAGCCGCAATATGGCTTTGGAGAGAAAGGAAAACCAGCCTCGAGT
GATGGAGGAGCAGTTCCACCTAATGCCACATTACAGATCAACTTAGAGTTGGTCTCGTGGAAAACTGTTTCAAATGTTACTGATGACAAG
AAAGTATTAAAGAAGATCTTGAAAGAAGGGGAAGGATATGAAAGACCCAATGAAGGAGCTGTTGTTAAATTAAAACTGGTTGGCAAGCTG
CTAGATGGCACAGTCTTCACAAAAAAGGGCCATGATGGGGAAAATGAAGACAATCTTTTTGAGTTTAAGACAGATGAGGAACAAGTAATA
GATGGGCTGGACCGAGCTGTCTTGACAATGAAGAAGGGTGAAGCGGCGCTGCTTACAATTGCACCTGAATATGCCTTTGGTTCATCTGAG
TCGAAGCAAGATTTAGCTGTTGTTCCTCCTAATTCAACTGTGCATTATGAGGTTGAGCTTGTTTCTTTTGTCAAGGACAAGGAATCATGG
GATATGAATACCCCGGAGAAAATTGAGTCTGCTGGCAAAAAGAAAGAAGAAGGGAATGCACTGTTCAAGGCTGGTAAATACGCAAGGGCA
TCTAAGAGATATGAGAAGGCTGCTAAATTCATCGAGTATGATACTTCCTTCAGCGAGGAGGAAAAGAAACAGTCTAAAGCATTGAAGATC
ACCTGCAACTTAAATAATGCAGCCTGCAAGTTGAAATTGAAAGATTACAAGCAGGCCGAGAAACTGTGTACCAAGGTGTTGGAACTGGAT
AGTGCAAATGTCAAAGCTCTTTACCGCAGAGCTCAAGCATATATGAACATGGCTGATCTTGATCTGGCTGAATTTGACATTAAGAAAGCT
CTTGAGATTGATCCTGACAACAGGGATGTGAAGCTTGAGTACAAAGCTCTAAAGGAGAAAGTCAAGGAAATTAACAAGAAGGACGCAAAG
TTCTACGGAAACATGTTTGCAAAGTTGACTAAGCAGGATGCAGCAAACTCAGCCAACTCTGCTCCTAAGGAACCAGAACCGATGAGCATT
GATGCAAGGCATAACTTTAACTCAGATATGACAAAAAAGGATCAGCATCATTATCTAGACTGTTCCAATGAGATGTCATATTTACCATGG
AGTCGTTATAGTTGGATTTTAGGAAAAAGTGXTTTGCTGAATAACTTGACTGTAATTTCTGATTCTGCATTGGGTACTTATATTAATGGA
TCCTCTTGTAATAGAGTTTCATCTGGCGTCTTTGGTGTGACATCTTTTAGTTAA\
Edits in Original Sequence 
CCCTTCGTCACGCTAAAAGCTCTCTCAAAAACCTTGGAACACTCTAGAACCTAAACCCTTTCTTTTCACACTATCTATCACACCATTTAA
GCCTCCATCTTCTTCATCTCCAACACGCCATTATTTACTTTCACTGAGCTCGATTCTATCAATCAATCAATCTTCTGTGTGTGAGTGCAT
ATTGTGTTTGACGGGAAA
(5')ATGGACGAGGATTTTGGTATTCCACCGGTAGAGGGAATGAACGAGGACATGGATCTGCCGGATGACAG
TTCGACCCTGAAAGTAGGCGAGGAGAAGGAAATTGGAAATCAGGGATTGAAGAAGAAGCTTGTTAAGGAAGGTGAAGGTTGGGATACTCC
TGCGCCTGGTGATGAAGTCGAAGTTCATTATACTGGAACTTTGCTTGAcGGAACCAAGTTCGATTCCAGTCGCGATAGAGGGGACCCCTT
CAAGXTTTACTCTCGGTCAAGGACAAGTTATTAAAGGATGGGATCAAGGTATAAATACAATGAAGAAAGGTGAAAATGCTATTTTCACCA
TTCCTCCAGAGCTTGCTTATGGAGAGAGTGGTTCTCCTCCAACTATCCCTCCAAATGCCACTCTACAATTTGATGTTGAGTTGCTATCAT
GGGTGAGTGTAAAAGACATTTGCAAGGATGGTGGAATTTTCAAAAAGATCCTCACAGAGGGGGAGAAATGGGAAAACCCGAAAGATCTTG
ACGAAGTATTTGTCAAGTACGAAGCTCAGCTTGAAAATGGCACAGTGGTGGGAAAATCAGATGGAGTGGAGTTCACTGTTCAAGATGGTC
ATTTCTGTCCTGCTCTTGCTAAGGCTGTGAAAACTATGAAGAAAGGTGAAAAGGTCCAATTGACAGTGAAGCCGCAATATGGCTTTGGAG
AGAAAGGAAAACCAGCCTCGAGTGATGGAGGAGCAGTTCCACCTAATGCCACATTACAGATCAACTTAGAGTTGGTCTCGTGGAAAACTG
TTTCAAATGTTACTGATGACAAGAAAGTATTAAAGAAGATCTTGAAAGAAGGGGAAGGATATGAAAGACCCAATGAAGGAGCTGTTGTTA
AATTAAAACTGGTTGGCAAGCTGCTAGATGGCACAGTCTTCACAAAAAAGGGCCATGATGGGGAAAATGAAGACAATCTTTTTGAGTTTA
AGACAGATGAGGAACAAGTAATAGATGGGCTGGACCGAGCTGTCTTGACAATGAAGAAGGGTGAAGCGGCGCTGCTTACAATTGCACCTG
AATATGCCTTTGGTTCATCTGAGTCGAAGCAAGATTTAGCTGTTGTTCCTCCTAATTCAACTGTGCATTATGAGGTTGAGCTTGTTTCTT
TTGTCAAGGACAAGGAATCATGGGATATGAATACCCCGGAGAAAATTGAGTCTGCTGGCAAAAAGAAAGAAGAAGGGAATGCACTGTTCA
AGGCTGGTAAATACGCAAGGGCATCTAAGAGATATGAGAAGGCTGCTAAATTCATCGAGTATGATACTTCCTTCAGCGAGGAGGAAAAGA
AACAGTCTAAAGCATTGAAGATCACCTGCAACTTAAATAATGCAGCCTGCAAGTTGAAATTGAAAGATTACAAGCAGGCCGAGAAACTGT
GTACCAAGGTGTTGGAACTGGATAGTGCAAATGTCAAAGCTCTTTACCGCAGAGCTCAAGCATATATGAACATGGCTGATCTTGATCTGG
CTGAATTTGACATTAAGAAAGCTCTTGAGATTGATCCTGACAACAGGGATGTGAAGCTTGAGTACAAAGCTCTAAAGGAGAAAGTCAAGG
AAATTAACAAGAAGGACGCAAAGTTCTACGGAAACATGTTTGCAAAGTTGACTAAGCAGGATGCAGCAAACTCAGCCAACTCTGCTCCTA
AGGAACCAGAACCGATGAGCATTGATaGCAAGGCATAACTTTAACTCAGATATGACAtAAAAAGGATCAGCATCATTATCTAGACTGTTC
CAATGAGATGTCATATTTACCATGGAGTCGTTATAGTTGGATTTTAGGAAAAAGTGXTTTGCTGAATAACTTGACTGTAATTTCTGATTC
TGCATTGGGTACTTATATTAATGGATCCTCTTGTAATAGAGTTTCATCTGGCGTCTTTGGTGTGACATCTTTTAGTTAA\(3')TTGTGT
TTTGTCCTTTTGTTGAGTGGAATTTATTGAAGGTCATTCGAAATTGATGTAGGCAAAATCAGTTCTTGAATTGCAAGCAAAGGCCGTACT
TCTAGAAATAATGATTGTGTACAATAATAGTAGTAAAAATTATGTAACGGCGGGATTTGGACAAAATCGAAGAAACAGAAGAAATCTCTG
ATGCTTAAGACAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan