ESTScan Details for Unigene SGN-U268749

Score 
1015
Direction 
Forward
Predicted Peptide Sequence 
KTVSSVTDDKKVIKKILKEGEGFEKPNAGAVVKMKLIGKLQDGTVFIKKGHNGENEDELFEFKTDEEQVIDGLDRAVMSMKKGEVALLII
APDYAFGPSESKQDLGVVPPNSTVYYEVELVSFVKEKESWDMNTQEKIEAAGKKKEEGNALFKAGKYARASTRYEKAAKFIEDDTDFSEE
EKKQAKALKISCNLNNAACKLKLKDYKQAEKLCTKVLETESTNVKALYRRAQAYMNMTDLDLAEFDIKKALEIDPNNRDVKLEYKAMKEK
VKEFNKKDAKFYGNMFAKLNKLDAXLDNSASKXPQPMSFDSKGIVVLADKSYFHGALLVVCAGSLMRENYTGFVESVLAFRKNYXNVYTG
FVA
Predicted Coding Sequence 
XGGAAGACTGTCTCAAGTGTAACTGACGATAAGAAAGTAATAAAGAAGATCTTAAAAGAAGGGGAAGGATTCGAGAAACCGAATGCAGGG
GCTGTGGTTAAAATGAAATTGATCGGCAAGCTACAAGATGGCACAGTCTTCATAAAGAAGGGCCACAATGGAGAAAATGAAGACGAGCTT
TTCGAGTTTAAGACAGATGAGGAGCAAGTTATAGATGGGTTGGATAGAGCTGTCATGTCAATGAAGAAGGGTGAAGTGGCACTGCTAATA
ATTGCACCTGATTATGCCTTTGGTCCATCTGAATCAAAGCAAGACTTAGGCGTTGTTCCTCCCAACTCAACTGTATATTATGAGGTTGAG
CTGGTTTCCTTTGTCAAGGAAAAGGAATCATGGGATATGAATACCCAGGAGAAAATTGAGGCTGCTGGCAAAAAGAAAGAGGAAGGAAAT
GCTCTCTTCAAGGCTGGTAAATATGCAAGAGCATCAACTAGATATGAGAAGGCTGCTAAATTTATTGAAGATGATACTGACTTTAGTGAA
GAGGAAAAGAAACAAGCTAAAGCTTTGAAGATCAGCTGCAACTTAAATAATGCAGCTTGCAAGTTGAAACTGAAAGATTACAAGCAGGCG
GAGAAGCTGTGTACCAAGGTGTTGGAAACTGAGAGTACTAATGTTAAAGCTCTTTACCGGAGAGCTCAAGCATATATGAACATGACAGAT
CTTGATCTAGCTGAATTTGACATTAAGAAAGCCCTTGAGATTGATCCTAACAACAGGGATGTGAAGCTTGAATACAAAGCTATGAAGGAG
AAAGTTAAGGAATTCAATAAGAAGGATGCAAAATTCTATGGGAACATGTTTGCTAAGTTAAATAAGTTGGATGCCAAXCTAGATAACTCC
GCTTCCAAGAAXCCACAACCAATGAGCTTTGACAGCAAAGGCATAGTTGTCTTAGCAGACAAGTCTTACTTTCATGGCGCGTTGTTAGTT
GTCTGTGCTGGATCTCTGATGCGGGAAAACTACACTGGATTTGTGGAATCAGTCTTAGCTTTTAGAAAAAATTACTXCAATGTTTACACT
GGATTTGTAGCT\
Edits in Original Sequence 
(5')XGGAAGACTGTCTCAAGTGTAACTGACGATAAGAAAGTAATAAAGAAGATCTTAAAAGAAGGGGAAGGATTCGAGAAACCGAATGC
AGGGGCTGTGGTTAAAATGAAATTGATCGGCAAGCTACAAGATGGCACAGTCTTCATAAAGAAGGGCCACAATGGAGAAAATGAAGACGA
GCTTTTCGAGTTTAAGACAGATGAGGAGCAAGTTATAGATGGGTTGGATAGAGCTGTCATGTCAATGAAGAAGGGTGAAGTGGCACTGCT
AATAATTGCACCTGATTATGCCTTTGGTCCATCTGAATCAAAGCAAGACTTAGGCGTTGTTCCTCCCAACTCAACTGTATATTATGAGGT
TGAGCTGGTTTCCTTTGTCAAGGAAAAGGAATCATGGGATATGAATACCCAGGAGAAAATTGAGGCTGCTGGCAAAAAGAAAGAGGAAGG
AAATGCTCTCTTCAAGGCTGGTAAATATGCAAGAGCATCAACTAGATATGAGAAGGCTGCTAAATTTATTGAAGATGATACTGACTTTAG
TGAAGAGGAAAAGAAACAAGCTAAAGCTTTGAAGATCAGCTGCAACTTAAATAATGCAGCTTGCAAGTTGAAACTGAAAGATTACAAGCA
GGCGGAGAAGCTGTGTACCAAGGTGTTGGAAACTGAGAGTACTAATGTTAAAGCTCTTTACCGGAGAGCTCAAGCATATATGAACATGAC
AGATCTTGATCTAGCTGAATTTGACATTAAGAAAGCCCTTGAGATTGATCCTAACAACAGGGATGTGAAGCTTGAATACAAAGCTATGAA
GGAGAAAGTTAAGGAATTCAATAAGAAGGATGCAAAATTCTATGGGAACATGTTTGCTAAGTTAAATAAGTTGGATGCCAAXCTAGATAA
CTCCGCTTCCAAGAAXCCACAACCAATGAGCTTTaGACAGCAAAGGCATAGTTGTCTTaAGCAGACAAGTCTTACTTTCATGGCGCGTTG
TTAGTTGTCTGTGCTGGATCTCTGATGCGGGAAAACTACACTGGATTTGTGGAATCAGTCTTAGCTTTTAGAAAAAATTACTXCAATGTT
TACACTGGATTTGTAGCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan