Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U268903

Score 
802
Direction 
Forward
Predicted Peptide Sequence 
GARALHGEIQQSQREITLAGFRSGKFLTLVATNVAARGLDINNVQLIVQCEPPRDVEAYIHRSGRTGRAGNTGVAVMLYDPKKSNISKIE
RESGVKFEHLSAPQPADVAKAAGKEAAEAIAEISDSVIPAFKAAAEELLHTSELSPAELLAKALAKAAGYSEIKSRSLLSSMENCVTLLL
GAGGPYFHLPLHIMFCGGFLSEDKVESIKGLTLTADGMGAVFDVSAX
Predicted Coding Sequence 
XCTGGGGCACGTGCTTTGCATGGAGAGATACAACAGTCCCAGCGTGAGATTACACTTGCTGGATTCAGATCAGGAAAGTTCCTTACATTA
GTGGCCACAAATGTAGCAGCCCGTGGATTGGATATCAACAACGTTCAGTTAATTGTTCAGTGTGAGCCTCCACGTGATGTTGAAGCGTAT
ATTCATCGATCTGGCAGGACAGGACGAGCAGGAAATACTGGTGTTGCTGTAATGCTTTACGATCCTAAGAAGTCCAACATCTCTAAGATT
GAAAGAGAATCTGGTGTCAAGTTCGAGCATCTATCTGCTCCACAGCCAGCTGATGTTGCTAAAGCTGCTGGGAAAGAAGCAGCAGAAGCA
ATTGCTGAAATTTCTGATAGTGTAATACCTGCTTTCAAGGCTGCTGCAGAGGAACTTCTACATACCTCTGAACTATCACCAGCTGAATTG
CTTGCGAAGGCACTTGCCAAGGCAGCTGGCTACTCTGAGATCAAGAGTCGTTCGCTTCTTTCTTCCATGGAGAACTGTGTTACTCTACTT
CTTGGTGCGGGAGGCCCATATTTTCACCTTCCTTTGCATATAATGTTTTGCGGGGGGTTCCTATCTGAGGACAAGGTTGAATCAATCAAA
GGTCTTACTTTGACAGCCGATGGAATGGGCGCAGTTTTTGATGTATCTGCTGAX\
Edits in Original Sequence 
(5')XCTGGGGCACGTGCTTTGCATGGAGAGATACAACAGTCCCAGCGTGAGATTACACTTGCTGGATTCAGATCAGGAAAGTTCCTTAC
ATTAGTGGCCACAAATGTAGCAGCCCGTGGATTGGATATCAACAACGTTCAGTTAATTGTTCAGTGTGAGCCTCCACGTGATGTTGAAGC
GTATATTCATCGATCTGGCAGGACAGGACGAGCAGGAAATACTGGTGTTGCTGTAATGCTTTACGATCCTAAGAAGTCCAACATCTCTAA
GATTGAAAGAGAATCTGGTGTCAAGTTCGAGCATCTATCTGCTCCACAGCCAGCTGATGTTGCTAAAGCTGCTGGGAAAGAAGCAGCAGA
AGCAATTGCTGAAATTTCTGATAGTGTAATACCTGCTTTCAAGGCTGCTGCAGAGGAACTTCTACATACCTCTGAACTATCACCAGCTGA
ATTGCTTGCGAAGGCACTTGCCAAGGCAGCTGGCTACTCTGAGATCAAGAGTCGTTCGCTTCTTTCTTCCATGGAGAACTGTGTTACTCT
ACTTCTTGaGTGCGGGAGGCCCATATTTTCACCTTCCTTTGCATATAATGTTTTGCGGGGGGTTCCTATCTGAGGACAAGGTTGAATCAA
TCAAAGGTCTTACTTTGACAGCCGATGGAATGGGCGCAGTTTTTGATGTATCTGCTGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan