ESTScan Details for Unigene SGN-U268966

Score 
244
Direction 
Forward
Predicted Peptide Sequence 
MELGCIMHVHMFKKQESGLLHISNVTQSKVTSMSNLLAVDEKVKVMVVKSMFPDKISLSIANLESEPGLFLSDKERVFSEAKQMAKKFRQ
NLPTVSATKKPEPLPTDRLPFEDEENMYANWKWFKFERDNETWNNPHTKNVSNCISFRHVFRSLDSIHDKVPLFKIPVIFFTELSNKSHC
YLTFLFGTILKFHIPFDISCLENIINEHKNNGELEGEGLLXRIAKTNX
Predicted Coding Sequence 
ATGGAACTTGGATGCATCATGCATGTGCATATGTTTAAGAAGCAGGAGAGTGGCTTGCTACACATCTCAAATGTCACCCAATCCAAGGTT
ACTTCCATGAGTAACTTGTTAGCAGTTGATGAGAAGGTGAAAGTTATGGTTGTGAAGTCAATGTTTCCTGACAAAATATCTCTCAGTATT
GCAAACCTTGAAAGCGAGCCAGGGTTATTTTTATCGGACAAGGAGAGAGTATTTTCTGAAGCAAAACAGATGGCGAAGAAGTTCAGACAG
AACCTACCAACTGTTTCAGCAACAAAGAAACCGGAACCCCTTCCAACCGACAGGCTTCCATTTGAAGATGAAGAAAATATGTATGCTAAT
TGGAAATGGTTCAAGTTTGAAAGGGATAATGAAACATGGAATAATCCCCACACTAAAAATGTATCGAACTGTATATCCTTTCGGCACGTC
TTTAGGTCCTTAGATAGCATCCATGACAAAGTACCATTGTTCAAAATCCCAGTTATATTCTTTACTGAACTGAGTAATAAGTCCCATTGT
TACTTAACTTTTCTTTTTGGCACAATTCTGAAGTTTCACATCCCTTTTGATATATCATGCCTTGAAAACATCATCAATGAGCACAAGAAC
AATGGTGAATTAGAAGGTGAAGGTTTACTTGXTCGCATTGCTAAGACTAATGXX\
Edits in Original Sequence 
TAGTAAAATTTGTGGGATTGCCTTATTTTATCACAGATCTATACTTGTATTGGATTATTATATCTATTTCTGTAGTGCCCTTACG(5')A
TGGAACTcTGGATGCATCATGCATGTGCATATGTTTAAGAAGCAGGAGAGTGGCTTGCTACACATCTCAAATGTCACCCAATCCAAGGTT
ACTTCCATGAGTAACTTGTTAGCAGTTGATGAGAAGGTGAAAGTTATGGTTGTGAAGTCAATGTTTCCTGACAAAATATCTCTCAGTATT
GCAAACCTTGAAAGCGAGCCAGGGTTATTTTTATCGGACAAGGAGAGAGTATTTTCTGAAGCAAAACAGATGGCGAAGAAGTTCAGACAG
AACCTACCAACTGTTTCAGCAACAAAGAAACCGGAACCCCTTCCAACCGACAGGCTTCCATTTGAAGATGAAGAAAATATGTATGCTAAT
TGGAAATGGTTCAAGTTTGAAAGGGATAATGtAAACATGGAATAATCCCCACACTAAAAATGTATCGAACTGTATATCCTTTCGGCACGT
CTTTAGGTCCTTAGATAGCATCCATGACAAAGTACCATTGTTCAAAATCCCAGTTATATTCTTTACTGAACTGAGTAATAAGTCCCATTG
TTACTTAACTTTTCTTTTTGGCACAATTCTGAAGTTTCACATCCCtTTTTGATATATCATGCCTTGAAAACATCATCAATGAGCACAAGA
ACAATGGTGAATTAGAAGGTGAAGGTTTACTTGXTCGCATTGCTAAGACTAATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan