ESTScan Details for Unigene SGN-U268974

Score 
1589
Direction 
Forward
Predicted Peptide Sequence 
MAIPNIRIPCRQLFIDGEWREPLKKNRLPIINPANEEIIGYIPAATEEDVDIAVKAARSALRRDDWGSTTGAQRAKYLRAIAAKVLEKKP
ELATLETIDNGKPWFEAASDIDDVVACFEYYADLAEALDSKKKTEVKLHLDSFKTHVLREPLGVVGLITPWNYPLLMTTWKVAPALAAGC
AAILKPSELASITSLELGEICREVGLPPGALSILTGLGHEAGSPLVSHPDVDKIAFTGSGPTGVKIMTAAAQLVKPVTLELGGKSPIVVF
DDIHDLDIAVEWTLFGCFWTNGQICSATSRLIIQETIAPQFLARLLEWTKNIKISDPLEEDCKLGPVISRGQYEKVLKFISTAKDEGATI
LYGGDRPEHLKKGYYIQPTIITDVDTSMEIWNEEVFGPVLCVKTFKTEEEAIELANDTKYGLGAAILSKDLERCERFTKAFQSGVAGSTA
RSHAFGXPPWGGKKRSGFGRELGEWSLENYLNIKQVTQYVTPDEPWAFYKSPSKLETFKWXKDYVNDEEPEMKLDXDVELASVVVIKSNK
SV
Predicted Coding Sequence 
ATGGCAATTCCTAATATACGGATCCCTTGTCGGCAGTTGTTCATCGACGGTGAATGGAGAGAACCCCTCAAGAAGAACCGGTTACCCATC
ATCAATCCGGCCAACGAAGAAATTATCGGGTATATTCCGGCAGCTACAGAGGAGGATGTAGATATTGCCGTCAAAGCTGCACGGAGTGCG
CTTCGTCGGGATGACTGGGGTTCTACTACTGGAGCACAGCGTGCCAAGTATCTTCGTGCTATTGCTGCTAAGGTACTGGAGAAAAAGCCT
GAACTAGCTACACTTGAGACGATTGATAATGGAAAACCCTGGTTCGAGGCTGCCTCGGATATAGATGATGTCGTAGCGTGTTTTGAGTAC
TATGCAGATCTCGCTGAAGCTTTGGATTCAAAAAAGAAGACTGAAGTTAAACTTCATTTGGATTCATTCAAGACCCATGTTTTAAGAGAA
CCTCTTGGTGTTGTGGGGTTGATTACTCCATGGAATTATCCTCTTTTGATGACCACATGGAAAGTCGCTCCTGCCCTAGCTGCTGGTTGT
GCAGCAATACTTAAGCCATCAGAACTAGCATCTATTACCTCTTTGGAGTTGGGTGAAATCTGTAGAGAGGTGGGTCTTCCTCCTGGTGCC
CTTAGCATACTAACGGGATTGGGACATGAAGCTGGTTCTCCTTTGGTATCACATCCTGATGTTGACAAGATTGCATTTACAGGAAGTGGC
CCAACAGGGGTCAAGATCATGACTGCTGCAGCTCAACTTGTTAAACCAGTTACTCTTGAGCTTGGTGGAAAAAGTCCAATAGTTGTGTTT
GATGACATTCATGACCTTGATATAGCTGTTGAGTGGACTCTTTTTGGCTGCTTTTGGACAAATGGTCAAATTTGCAGTGCAACATCACGT
CTTATAATACAGGAAACAATTGCTCCACAATTTTTGGCCAGGCTTCTTGAGTGGACAAAAAACATTAAAATCTCAGATCCCTTGGAAGAA
GACTGCAAGCTTGGTCCTGTCATTAGTCGTGGACAGTATGAGAAGGTCTTGAAGTTCATCTCTACAGCCAAAGATGAAGGTGCAACCATT
CTTTATGGTGGCGACCGTCCTGAGCACTTAAAGAAAGGATATTACATTCAACCAACAATCATAACTGATGTTGATACGTCCATGGAAATC
TGGAATGAGGAGGTATTTGGACCTGTTCTTTGTGTCAAAACATTTAAAACTGAAGAGGAAGCCATTGAACTAGCAAATGATACCAAGTAT
GGTTTGGGTGCTGCTATTTTGTCAAAAGATCTTGAAAGATGTGAACGTTTCACAAAGGCTTTTCAGTCAGGGGTTGCTGGATCAACTGCT
CGCAGCCATGCTTTTGGCAAXCCACCATGGGGGGGTAAGAAGCGTAGTGGTTTTGGACGTGAGCTTGGGGAATGGAGTCTAGAGAACTAC
CTAAACATTAAACAGGTGACTCAGTATGTGACTCCGGACGAACCATGGGCTTTTTACAAGTCTCCTTCAAAGCTTGAAACTTTCAAGTGG
XTCAAGGATTATGTGAATGATGAAGAACCAGAGATGAAACTTGATXCTGATGTAGAACTAGCGTCGGTTGTTGTTATCAAGTCTAATAAA
TCTGTTTGA\
Edits in Original Sequence 
TTATCAAATTCTTTAGCTATAAAGCAGGAATCAGCACTCCATTTTTTTTACTCATATCAGTAGCATTTAGCACACACTTTCACAAAATAC
TGAAAGTGAAGTGATCAAGTGTAGAGAGAGCC
(5')ATGGCAATTCCTAATATACGGATCCCTTGTCGGCAGTTGTTCATCGACGGTGAA
TGGAGAGAACCCCTCAAGAAGAACCGGTTACCCATCATCAATCCGGCCAACGAAGAAATTATCGGGTATATTCCGGCAGCTACAGAGGAG
GATGTAGATATTGCCGTCAAAGCTGCACGGAGTGCGCTTCGTCGGGATGACTGGGGTTCTACTACTGGAGCACAGCGTGCCAAGTATCTT
CGTGCTATTGCTGCTAAGGTACTGGAGAAAAAGCCTGAACTAGCTACACTTGAGACGATTGATAATGGAAAACCCTGGTTCGAGGCTGCC
TCGGATATAGATGATGTCGTAGCGTGTTTTGAGTACTATGCAGATCTCGCTGAAGCTTTGGATTCAAAAAAGAAGACTGAAGTTAAACTT
CATTTGGATTCATTCAAGACCCATGTTTTAAGAGAACCTCTTGGTGTTGTGGGGTTGATTACTCCATGGAATTATCCTCTTTTGATGACC
ACATGGAAAGTCGCTCCTGCCCTAGCTGCTGGTTGTGCAGCAATACTTAAGCCATCAGAACTAGCATCTATTACCTCTTTGGAGTTGGGT
GAAATCTGTAGAGAGGTGGGTCTTCCTCCTGGTGCCCTTAGCATACTAACGGGATTGGGACATGAAGCTGGTTCTCCTTTGGTATCACAT
CCTGATGTTGACAAGATTGCATTTACAGGAAGTGGCCCAACAGGGGTCAAGATCATGACTGCTGCAGCTCAACTTGTTAAACCAGTTACT
CTTGAGCTTGGTGGAAAAAGTCCAATAGTTGTGTTTGATGACATTCATGACCTTGATATAGCTGTTGAGTGGACTCTTTTTGGCTGCTTT
TGGACAAATGGTCAAATTTGCAGTGCAACATCACGTCTTATAATACAGGAAACAATTGCTCCACAATTTTTGGCCAGGCTTCTTGAGTGG
ACAAAAAACATTAAAATCTCAGATCCCTTGGAAGAAGACTGCAAGCTTGGTCCTGTCATTAGTCGTGGACAGTATGAGAAGGTCTTGAAG
TTCATCTCTACAGCCAAAGATGAAGGTGCAACCATTCTTTATGGTGGCGACCGTCCTGAGCACTTAAAGAAAGGATATTACATTCAACCA
ACAATCATAACTGATGTTGATACGTCCATGGAAATCTGGAATGAGGAGGTATTTGGACCTGTTCTTTGTGTCAAAACATTTAAAACTGAA
GAGGAAGCCATTGAACTAGCAAATGATACCAAGTATGGTTTGGGTGCTGCTATTTTGTCAAAAGATCTTGAAAGATGTGAACGTTTCACA
AAGGCTTTTCAGTCAGGGGTTGtCTGGATCAACTGCTCGCAGCCATGCTTTTGGCAAXCCACCATGGGGGGGTAAGAAGCGTAGTGGTTT
TGGACGTGAGCTTGGGGAATGGAGTCTAGAGAACTACCTAAACATTAAACAGGTGACTCAGTATGTGACTCCGGACGAACCATGGGCTTT
TTACAAGTCTCCTTCAAAGCTgTGAAACTTTCAAGTGGXTCAAGGATTATGTGAATGATGAAGAACCAGAGATGAAACTTGATXCTGATG
TAGAACTAGCGTCGGTTGTTGTTATCAAGTCTAATAAATCTGTTTGA\(3')AGGGACAAAATGTGGACTACATTTATTTTACTGATATT
GCGTTCCTCTTCTGTTTATTGCATCTTTGAGAGCAAAGTGTCAATCTTGGATTCATCATAGAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan