ESTScan Details for Unigene SGN-U269030

Score 
872
Direction 
Forward
Predicted Peptide Sequence 
MAGRVDLDGNPIKQITICMIGAGGFIGSHLCEKLLSETPHKVLAVDVYSDKIKHLLEPATVTWADRIQFHRINIKNDSRLEGLIKMADLT
INLAAICTPADYNTRPLDTIYSNFVDALPVVKYCSENGKRLIHFSTCEVYGKTIGAFLPKDSPLRQDPAYYVLKEDTSPCIFGPIEKQRW
SYACAKQLIERLVYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRREPLKLVDGGESQRTFIYIKDAIEAVL
LMIENPARANGHIFNVGNPNNEVTVRQLAEMMTKVYSKVSGESSIETPTIDVSSKEFYGEGYDDSDKRIPDMTIINRQLGWNPKTSLWDL
LESTLTYQHRTYAEAVKQAMSKTTAN
Predicted Coding Sequence 
ATGGCAGGAAGAGTAGATCTGGACGGTAATCCCATAAAACAGATTACGATATGCATGATTGGTGCCGGTGGATTCATTGGTTCTCATTTA
TGTGAGAAGCTTTTGTCGGAGACTCCTCATAAGGTGCTAGCCGTCGATGTTTACAGTGATAAGATTAAGCATTTGCTTGAACCGGCGACG
GTTACTTGGGCTGATCGAATTCAGTTTCATAGAATCAATATTAAGAATGATTCTCGCCTTGAAGGTCTCATCAAAATGGCAGATCTGACC
ATAAATCTTGCTGCGATCTGTACTCCAGCAGATTATAACACTCGTCCACTTGATACAATTTACAGCAATTTCGTTGATGCTCTACCAGTG
GTCAAGTACTGCTCAGAAAATGGAAAGCGTCTCATTCACTTCTCAACTTGTGAAGTTTACGGGAAAACCATAGGTGCCTTTTTACCCAAA
GACAGCCCACTGCGGCAGGATCCTGCTTATTATGTGCTTAAGGAAGACACCTCCCCTTGCATCTTTGGACCAATTGAGAAGCAGCGGTGG
TCCTATGCGTGTGCAAAACAATTGATTGAGAGGCTGGTCTATGCTGAGGGTGCGGAGAATGGCTTAGAGTTCACTATTGTAAGGCCATTT
AACTGGATTGGTCCTAGGATGGATTTCATTCCTGGCATCGATGGTCCTAGTGAAGGTGTTCCAAGAGTATTAGCTTGCTTTAGTAATAAC
CTTTTAAGACGTGAACCTTTGAAACTTGTGGATGGGGGAGAATCACAAAGGACGTTCATATACATCAAAGATGCTATTGAAGCTGTTCTT
CTAATGATCGAAAATCCTGCCAGAGCCAATGGCCATATCTTTAATGTTGGTAACCCTAACAATGAAGTTACTGTCAGGCAGCTGGCTGAA
ATGATGACTAAGGTGTACTCAAAGGTGAGTGGAGAGTCTTCTATTGAAACACCCACCATTGATGTAAGTTCTAAAGAATTTTATGGTGAG
GGGTATGATGACAGTGACAAGAGGATTCCGGACATGACCATAATCAACAGGCAGCTTGGTTGGAACCCAAAGACTTCCCTATGGGACTTG
CTAGAATCCACACTCACATACCAACACAGGACCTATGCCGAGGCTGTCAAGCAGGCCATGTCTAAAACAACAGCAAATTGA\
Edits in Original Sequence 
GATTCACTTCAATATAGAGAGAGAAATTGAAAAAATATCTTTAAAAAATTGTAGTGAGAGAGGATTAGCAGTAATCGGAA(5')ATGGCA
GGAAGAGTAGATCTGGACGGTAATCCCATAAAACAGATTACGATATGCATGATTGGTGCCGGTGGATTCATTGGTTCTCATTTATGTGAG
AAGCTTTTGTCGGAGACTCCTCATAAGGTGCTAGCCGTCGATGTTTACAGTGATAAGATTAAGCATTTGCTTGAACCGGCGACGGTTACT
TGGGCTGATCGAATTCAGTTTCATAGAATCAATATTAAGAATGATTCTCGCCTTGAAGGTCTCATCAAAATGGCAGATCTGACCATAAAT
CTTGCTGCGATCTGTACTCCAGCAGATTATAACACTCGTCCACTTGATACAATTTACAGCAATTTCGTTGATGCTCTACCAGTGGTCAAG
TACTGCTCAGAAAATGGAAAGCGTCTCATTCACTTCTCAACTTGTGAAGTTTACGGGAAAACCATAGGTGCCTTTTTACCCAAAGACAGC
CCACTGCGGCAGGATCCTGCTTATTATGTGCTTAAGGAAGACACCTCCCCTTGCATCTTTGGACCAATTGAGAAGCAGCGGTGGTCCTAT
GCGTGTGCAAAACAATTGATTGAGAGGCTGGTCTATGCTGAGGGTGCGGAGAATGGCTTAGAGTTCACTATTGTAAGGCCATTTAACTGG
ATTGGTCCTAGGATGGATTTCATTCCTGGCATCGATGGTCCTAGTGAAGGTGTTCCAAGAGTATTAGCTTGCTTTAGTAATAACCTTTTA
AGACGTGAACCTTTGAAACTTGTGGATGGGGGAGAATCACAAAGGACGTTCATATACATCAAAGATGCTATTGAAGCTGTTCTTCTAATG
ATCGAAAATCCTGCCAGAGCCAATGGCCATATCTTTAATGTTGGTAACCCTAACAATGAAGTTACTGTCAGGCAGCTGGCTGAAATGATG
ACTAAGGTGTACTCAAAGGTGAGTGGAGAGTCTTCTATTGAAACACCCACCATTGATGTAAGTTCTAAAGAATTTTATGGTGAGGGGTAT
GATGACAGTGACAAGAGGATTCCGGACATGACCATAATCAACAGGCAGCTTGGTTGGAACCCAAAGACTTCCCTATGGGACTTGCTAGAA
TCCACACTCACATACCAACACAGGACCTATGCCGAGGCTGTCAAGCAGGCCATGTCTAAAACAACAGCAAATTGA\(3')TTGTTCGCTG
CTTGTTGGCAGGTCTTTCAATATCTTGTTACGATTCTCCCGAGTAAAAATCTACAGTCCATCACTCATACACGTAATTTTACGTCCCTTC
TGTAATCAATCATGTATTCTATTTTGTGACAGCATATTTATTAAGAAATTTGTGTCATAGGCTGGGTGTATTATGTCACTAGAGCTTCAA
ATAGTTATTGGGGTATTAGATAAAGGAAAAGCTGTCCTGTTCTTGTAAGATTTGTTGTCATTCATCTATTCATTCCTGTGTATGGAAACA
TCTTGTATCATTTTGATCGACCTATTGATGGAGCTATAAATTTTTCCTATTTATTCAAAAAAAAAAAAAAAAAACTGAACTAGTCTCTCT
C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan