ESTScan Details for Unigene SGN-U269032

Score 
652
Direction 
Forward
Predicted Peptide Sequence 
RTSGSPAXCMAQATLLPPFPSSKNINYTERIFLWKMAGRVDLDGNPIKPMTICMIGAGGFIGSPLMREAHVGNAAHGARRRRLQDKIKHL
LEPTSLPWNGRIQFHRINIKNDSRLEGLIKMADLTVNLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENGKRLIHFSTCEVYGKTIG
AFLPEDSPLRQDPAYFVLSEEASPCIFGPIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLA
CFSNNLLRHEPLKLVDGGHSQRTFIYIKDAIEAVFLMIENPARANGHIFNVGNPNNEVTVKQLAEMMTQVYSKVSGETPLETPTVDVSSK
EFYGEGYDDSDKRIPDMTIINRQLGWNPKTSLWDLLESTLTYQHRTYAEAVKQAMSKTTAN
Predicted Coding Sequence 
AGAACTAGTGGATCCCCCGCGGNCTGCATGGCACAAGCGACTCTCCTCCCTCCTTTTCCTTCTTCTAAAAACATCAACTATACAGAGAGA
ATTTTTCTGTGGAAAATGGCAGGGAGGGTAGATCTAGACGGCAATCCGATCAAGCCGATGACGATTTGCATGATCGGCGCCGGTGGCTTC
ATTGGCTCXCCACTTATGCGAGAAGCTCATGTCGGAAACGCCGCACACGGTGCTCGCCGTCGACGTTTACAGGATAAAATCAAGCATCTA
CTTGAACCGACTTCTCTACCTTGGAATGGAAGGATACAGTTCCACAGAATTAACATTAAGAATGATTCTCGCCTTGAAGGACTCATCAAA
ATGGCAGATCTGACTGTAAATCTTGCTGCGATCTGCACTCCAGCTGATTATAATACACGTCCACTTGACACAATCTACAGCAACTTCATT
GATGCTCTACCAGTGGTTAAGTACTGCTCAGAAAATGGAAAGCGTCTCATTCACTTTTCCACTTGTGAAGTGTATGGGAAAACCATAGGT
GCCTTTTTACCCGAAGACAGCCCATTGCGGCAGGATCCTGCTTATTTTGTTCTTTCGGAAGAGGCATCTCCATGCATTTTTGGACCTATT
GAGAAGCAAAGGTGGTCCTATGCCTGTGCAAAGCAATTGATTGAGAGATTGATCTATGCTGAGGGTGCTGAGAATGGCTTAGAATTCACC
ATTGTTAGGCCCTTCAATTGGATTGGCCCCAGGATGGATTTTATACCCGGGATCGATGGTCCTAGTGAAGGTGTTCCAAGAGTATTGGCT
TGCTTTAGTAATAACCTATTAAGACATGAACCACTAAAACTAGTGGACGGTGGACACTCGCAGAGAACCTTCATATATATCAAGGATGCT
ATTGAAGCTGTATTCCTGATGATTGAAAATCCTGCACGGGCCAACGGCCATATCTTTAACGTTGGCAATCCTAATAACGAAGTTACTGTC
AAGCAGCTAGCTGAAATGATGACTCAGGTGTACTCAAAGGTGAGTGGAGAAACTCCTCTTGAAACACCCACCGTCGATGTAAGTTCTAAA
GAATTTTATGGCGAGGGGTATGATGACAGTGACAAGCGAATTCCAGACATGACCATAATCAACAGACAGCTCGGTTGGAACCCAAAGACA
TCCCTATGGGACTTGCTTGAATCCACACTCACTTACCAACATAGGACATACGCTGAGGCTGTCAAGCAGGCGATGTCAAAGACAACAGCA
AATTGA\
Edits in Original Sequence 
(5')AGAACTAGTGGATCCCCCGCGGNCTGCATGGCACAAGCGACTCTCCTCCCTCCTTTTCCTTCTTCTAAAAACATCAACTATACAGA
GAGAATTTTTCTGTGGAAAATGGCAGGGAGGGTAGATCTAGACGGCAATCCGATCAAGCCGATGACGATTTGCATGATCGGCGCCGGTGG
CTTCATTGGCTCXCCACTTATGCGAGAAGCTCATGTCGGAAACGCCGCACACGGTGCTCGCCGTCGACGTTTACAGtGATAAAATCAAGC
ATCTACTTGAACCGACTTCTCTACCTTGGAATGGAAGGATACAGTTCCACAGAATTAACATTAAGAATGATTCTCGCCTTGAAGGACTCA
TCAAAATGGCAGATCTGACTGTAAATCTTGCTGCGATCTGCACTCCAGCTGATTATAATACACGTCCACTTGACACAATCTACAGCAACT
TCATTGATGCTCTACCAGTGGTTAAGTACTGCTCAGAAAATGGAAAGCGTCTCATTCACTTTTCCACTTGTGAAGTGTATGGGAAAACCA
TAGGTGCCTTTTTACCCGAAGACAGCCCATTGCGGCAGGATCCTGCTTATTTTGTTCTTTCGGAAGAGGCATCTCCATGCATTTTTGGAC
CTATTGAGAAGCAAAGGTGGTCCTATGCCTGTGCAAAGCAATTGATTGAGAGATTGATCTATGCTGAGGGTGCTGAGAATGGCTTAGAAT
TCACCATTGTTAGGCCCTTCAATTGGATTGGCCCCAGGATGGATTTTATACCCGGGATCGATGGTCCTAGTGAAGGTGTTCCAAGAGTAT
TGGCTTGCTTTAGTAATAACCTATTAAGACATGAACCACTAAAACTAGTGGACGGTGGACACTCGCAGAGAACCTTCATATATATCAAGG
ATGCTATTGAAGCTGTATTCCTGATGATTGAAAATCCTGCACGGGCCAACGGCCATATCTTTAACGTTGGCAATCCTAATAACGAAGTTA
CTGTCAAGCAGCTAGCTGAAATGATGACTCAGGTGTACTCAAAGGTGAGTGGAGAAACTCCTCTTGAAACACCCACCGTCGATGTAAGTT
CTAAAGAATTTTATGGCGAGGGGTATGATGACAGTGACAAGCGAATTCCAGACATGACCATAATCAACAGACAGCTCGGTTGGAACCCAA
AGACATCCCTATGGGACTTGCTTGAATCCACACTCACTTACCAACATAGGACATACGCTGAGGCTGTCAAGCAGGCGATGTCAAAGACAA
CAGCAAATTGA\(3')ATGAAGTCGGAGCAGAGCTTTACTGTGTGTAATCTTCATCTACTCGGTTCGACTTCATCCACGTTATTTATTCT
CTTTGTCATCCTCTTCATGCAAACCTATAATAGGTGACAACAGATTCATTATGAAATTATGCCTTAGCTACAACAGTTTTTGACGCATTA
TAGTCAAAAGAAGCCTGGAGTCTGCTCATGATTTTGTTGTCATTATATTATCATTCTACTGTAATGGAAGTATGTTGTATCATTACACAT
ATTTTCCTTATCTAATTACTAGTATAAAGTATAATTTATTTGTTTGATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan