ESTScan Details for Unigene SGN-U269254

Score 
533
Direction 
Forward
Predicted Peptide Sequence 
MGSEGPSPVIVHVTGFKKFHGVAENPTETIVSNLKDYMKKRGMPKGLILGSCSILDTAGQGALVPLYQTLQAGLSGGDSESSNSRRVIWV
HFGVNSGATMFAIENQAVNEATFRCPDEMGWKPQKVPIVPADGAISRKRETSLPVEEMTKVLAKMGYEVMTSDDAGRFVCNYVYYHSLRF
AEQNGVRSLFVHVPLFLTIDEETQMQFAASXAGATRLFILVLDFCVRKCICLVIYAVYAEEG
Predicted Coding Sequence 
ATGGGGTCCGAAGGGCCTTCACCTGTGATCGTACATGTGACTGGTTTCAAGAAATTTCATGGAGTTGCTGAAAATCCAACAGAAACCATT
GTAAGTAATCTTAAAGATTATATGAAGAAAAGGGGTATGCCCAAAGGGCTGATCCTTGGGAGTTGCAGCATCCTTGATACTGCAGGCCAG
GGAGCCCTAGTTCCCTTGTATCAGACACTGCAAGCTGGTTTAAGTGGTGGTGACTCGGAGTCATCTAATTCCAGGAGAGTTATTTGGGTA
CATTTTGGAGTTAATAGTGGTGCCACAATGTTTGCCATAGAGAATCAGGCTGTCAATGAAGCTACTTTCCGTTGTCCAGATGAGATGGGA
TGGAAGCCTCAGAAAGTCCCTATTGTTCCTGCAGATGGGGCAATTTCACGTAAACGAGAGACTTCTCTTCCGGTGGAGGAAATGACCAAG
GTATTGGCAAAGATGGGATATGAAGTAATGACCTCTGATGATGCAGGCCGGTTTGTATGCAATTATGTATACTACCATTCCTTGCGTTTT
GCAGAGCAGAATGGTGTCCGATCACTATTTGTACACGTGCCCCTCTTCCTAACCATAGACGAGGAGACACAAATGCAATTTGCTGCTTCT
TXTGCTGGAGCTACTCGCCTCTTTATACTAGTCCTTGACTTCTGTGTCCGGAAGTGTATTTGCCTTGTTATTTATGCTGTGTATGCAGAA
GAAGGTTGA\
Edits in Original Sequence 
TTAAAGTTAAGGCAATTATCTGAGAAGTGAGATTATTGCAATTTGCAAGTCAAGAAGGCAAAACAAACAAACAACAAAGTCATGACAATA
ATTACGTAAAACATATTTTATAATAATAATATGATTTCTTGTTTTATATTATAACAACCCACCACTACCACGTTCTTTATCCATATTTTT
TTTAATTATTTTAATAATATTCCAAAATTTTACTCATCAATAATGAAGAATCCCAATCAGTAGTCTTCTACCATTATAATCACCTTTTGA
TCAGATAAGACCACTTGCTTCAGTCCTTTATTCGTTTGGCTCTCTCTCTTTCAGCTTTCAGTTTCGTCTGACTAGGGGATAG
(5')ATGG
GGTCCGAAGGGCCTTCACCTGTGATCGTACATGTGACTGGTTTCAAGAAATTTCATGGAGTTGCTGAAAATCCAACAGAAACCATTGTAA
GTAATCTTAAAGATTATATGAAGAAAAGGGGTATGCCCAAAGGGCTGATCCTTGGGAGTTGCAGCATCCTTGATACTGCAGGCCAGGGAG
CCCTAGTTCCCTTGTATCAGACACTGCAAGCTGGTTTAAGTGGTGGTGACTCGGAGTCATCTAATTCCAGGAGAGTTATTTGGGTACATT
TTGGAGTTAATAGTGGTGCCACAATGTTTGCCATAGAGAATCAGGCTGTCAATGAAGCTACTTTCCGTTGTCCAGATGAGATGGGATGGA
AGCCTCAGAAAGTCCCTATTGTTCCTGCAGATGGGGCAATTTCACGTAAACGAGAGACTTCTCTTCCGGTGGAGGAAATGACCAAGGTAT
TGGCAAAGATGGGATATGAAGTAATGACCTCTGATGATGCAGGCCGGTTTGTATGCAATTATGTATACTACCATTCCTTGCGTTTTGCAG
AGCAGAATGGTGTCCGATCACTATTTGTACACGTGCCCCTCTTCCTAACCATAGACGAGGAGACACAAATGCAATTTGCTGCTTCTTXTG
CTGGAGCTACTCGCCTCTTTATACTAGTCCTTGACTTCTGTGTCCGGAAGTGTATTTGCCTTGTTATTTATGCTGTGTATGCAGAAGAAG
GTTGA\(3')TCTGGATATAAATGTAATGCTTTAATAAACGGTGAACTTTTAGTGAATGGCAAATGCATTTGGTGTGTACATGTATCTTC
GTCAACATTCCTTGGGTGGTTAATCTCGTTGATTTGGAGATGTTTCATGCTTATGTGCGAGCAAACTTACAGCTTTCTGTATCTTCTTTT
CAAAGTAATGGACATGATAGGAACTTGTCCTTCAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan