Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U269264

Score 
511
Direction 
Forward
Predicted Peptide Sequence 
MKIQCDVCEKAQATVICCADEAALCAKCDIEVHAANKLASKHQRLHLQCLSNKLPPCDICQDKAAFIFCVEDRALFCKDCDEAIHSASSL
AKNHQRFLATGIRVALSSSCNKEAXKKPTGATTTSAEFSTSWLENAYAAIAGITSPSWPVDDLLGFPDYESSDXKDLLELX
Predicted Coding Sequence 
ATGAAGATCCAGTGTGATGTGTGTGAGAAAGCTCAAGCTACTGTGATTTGCTGTGCTGATGAGGCTGCTTTGTGTGCAAAATGTGATATT
GAAGTTCATGCTGCTAATAAATTAGCAAGTAAGCATCAGAGGCTTCATCTTCAGTGCCTATCTAACAAGCTTCCTCCTTGTGATATTTGC
CAAGATAAAGCAGCCTTCATCTTCTGTGTTGAGGATAGAGCTCTCTTTTGCAAGGACTGTGACGAAGCAATTCATTCAGCCAGCAGCCTC
GCCAAGAACCACCAACGCTTCTTAGCCACTGGAATCCGTGTAGCCTTGAGCTCAAGCTGCAATAAGGAAGCAGXTAAAAAACCAACTGGA
GCCACAACCACCTCAGCAGAATTCTCAACAAGTTGGCTTGAAAATGCCTACGCAGCAATTGCTGGTATCACATCACCATCTTGGCCTGTC
GATGATTTACTAGGATTTCCAGATTATGAGTCTAGTGACNAGAAGGATCTACTTGAGCTTGXX\
Edits in Original Sequence 
CTTCCACTCATTTCATTCTCTATATTTTCTTTTCTTCTTCTTTCTCCTCCCATTTTTCACATTTCAAAGACCACATTTTTCTGTTTTTGA
TTGAAAGTTTTCATTTTTATTACTTTGGACTAATCACATGCTTTGGGTTTTCTTGTTTTCTGCAGGTTTTTTTTTGTCTGACTGACCATT
TTTGGCATATCAGAGTTTGGGTATTTTTCAAATCTTGAAAAGTTCTGACTTCTCTTCCCAAAAAACTTCAAGACACTATTTTTCCTCTTT
TTCTTGTGTGAAACTCAAAAGGGTATGTCTTGAATTAGTGTTAGGAGGCAAGAGTTGAGTAATAAAAG
(5')ATGAAGATCCAGTGTGAT
GTGTGTGAGAAAGCTCAAGCTACTGTGATTTGCTGTGCTGATGAGGCTGCTTTGTGTGCAAAATGTGATATTGAAGTTCATGCTGCTAAT
AAATTAGCAAGTAAGCATCAGAGGCTTCATCTTCAGTGCCTATCTAACAAGCTTCCTCCTTGTGATATTTGCCAAGATAAAGCAGCCTTC
ATCTTCTGTGTTGAGGATAGAGCTCTCTTTTGCAAGGACTGTGACGAAGCAATTCATTCAGCCAGCAGCCTCGCCAAGAACCACCAACGC
TTCTTAGCCACTGGAATCCGTGTAGCCTTGAGCTCAAGCTGCAATAAGGAAGCAGXTAAAAAACCAACTGGAGCCACAACCACCTCAGCA
GAATTCTCAACAAGTTGGCTTGAAAATGCCTACGCAGCAATTGtCTGGTATCACATCACCATCTTGGCCTGTCGATGATTTACTAGGATT
TCCAGATTATGAGTCTAGTGACNAGAAGGATCTACTTGAGCTTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan